Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002146-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00002146-protein
Unique NameTCONS_00002146-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length780

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00002146-protein ID=TCONS_00002146-protein|Name=TCONS_00002146-protein|organism=Clytia hemisphaerica|type=polypeptide|length=780bp
MRGFIGFVIVQFLLGLCWSISQKIAHVEFHEYEGIDDDTSCTRCKMSFEF
EVSLTSDRSKVLGKSTIAPFDIDGKTNKFTINSVIIFDLDRFGVSYDIKA
EIKRHTGRRYEVVTSLDSLNKTFSIDSSQATGKNIDGDIDKTASGKARTI
KWEFRVYCNDSDYLLPDCTIERCVPRDDTNGHYTCDSQNNKVCLQGWVDA
TTNCVTQNVTKPSISSSIAVSQSTSISSLAVKTSSIEPSFSVLATSSMLP
SFTPSSQIDETSLLATSYNTISSDMFSTSISFIGSSTSSLMVLETSLSSA
VETSMASSPIDLETSSSLIFESSSVSLPITSSPILPTTQQFSSSINMEST
SPTPSTTLFLESSFSSSMNSKAMSTIIQSISMTSISSSFMESSNTSSNKT
SASTTNNLSIISSNVTGEKPTISSTMFLPLKPESIQPSNAATLPASSTIV
IVLPGKPVQVTRADDKWKWILIIVGSSAIFLIFLLCCCFCCQRRRLRRKL
EQHEAQIEELREMSRNNNSSLRGRTYSNVSLDKEEAIQRHEKNKDLLAQD
GSEFIGFTNEMFQPDTSRTEVRRPSLGPSRLQPPQKRSNRIPSLSDAALF
PHPPFDFMNPLHEDEHKGKPRSSSPANAVQKNGNPQDAGPPSPPPPPPPP
PPAQPQTPVKIRSSTLNSLDRFQQQQNTSPMDSLLGEFKKKISVTEAPSN
DQIRPVRASTFSKNAHKDTPSKPRRTATDVNKLPTAKKPNRMPAKKAMNG
HVNGDTNENEFEGFYNRTFNPEMNESASRF
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_001119XLOC_001119Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00002146TCONS_00002146Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001774DSL
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0007154cell communication
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007154 cell communication
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 493..520
NoneNo IPR availableGENE3D1.20.5.900coord: 467..516
e-value: 1.2E-5
score: 24.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..759
IPR001774Delta/Serrate/lag-2 (DSL) proteinPFAMPF01414DSLcoord: 143..199
e-value: 4.1E-10
score: 39.6

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002146-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top