Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001849-protein ID=TCONS_00001849-protein|Name=TCONS_00001849-protein|organism=Clytia hemisphaerica|type=polypeptide|length=297bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001849-protein vs. Swiss-Prot (Human)
Match: DRGX (Dorsal root ganglia homeobox protein OS=Homo sapiens GN=DRGX PE=3 SV=1) HSP 1 Score: 108.227 bits (269), Expect = 8.712e-28 Identity = 49/64 (76.56%), Postives = 54/64 (84.38%), Query Frame = 0 Query: 77 YARRGHRRNRTTFTRQQLEELEKLFDSTHYPDVFAREELASRISLTEARVQVWFQNRRAKFRKT 140 + RR RRNRTTFT QQLE LE +F THYPDVF REELA +I+LTEARVQVWFQNRRAK+RKT Sbjct: 28 FLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKT 91 The following BLAST results are available for this feature:
BLAST of TCONS_00001849-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|