Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001849-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001849-protein
Unique NameTCONS_00001849-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length297

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001849-protein ID=TCONS_00001849-protein|Name=TCONS_00001849-protein|organism=Clytia hemisphaerica|type=polypeptide|length=297bp
MRIMMHNQPCHQFYSVDGILSAMSPSHQQRHCEQSVVSGGGGQPMPPPSH
SPAPYWHAGSHYGAEHSAITHGYPPPYARRGHRRNRTTFTRQQLEELEKL
FDSTHYPDVFAREELASRISLTEARVQVWFQNRRAKFRKTSEKNKRKSNS
TSSSSSTNQNTDLSSTANQMATTNNNNNSTINNNNNGETVIDKQSNEVDE
QIRLKNDSIESTEKQILDHNTRLPEDINNKYNSTAPRLTHPPYTFHTYQG
TYCPSSYGSMEPRVVNGVSYPVSVEGVKGESYGRNTLVNNGDLDWRA
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000977XLOC_000977Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001849TCONS_00001849Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR017970Homeobox_CS
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 82..144
e-value: 1.8E-25
score: 100.6
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 83..139
e-value: 1.0E-23
score: 82.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 80..140
score: 20.779
NoneNo IPR availableGENE3D1.10.10.60coord: 77..151
e-value: 1.3E-28
score: 98.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..189
NoneNo IPR availableCDDcd00086homeodomaincoord: 83..141
e-value: 2.59454E-22
score: 86.9136
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 115..138
IPR009057Homeobox domain-likeSUPERFAMILY46689Homeodomain-likecoord: 61..140

Blast
BLAST of TCONS_00001849-protein vs. Swiss-Prot (Human)
Match: DRGX (Dorsal root ganglia homeobox protein OS=Homo sapiens GN=DRGX PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 8.712e-28
Identity = 49/64 (76.56%), Postives = 54/64 (84.38%), Query Frame = 0
Query:   77 YARRGHRRNRTTFTRQQLEELEKLFDSTHYPDVFAREELASRISLTEARVQVWFQNRRAKFRKT 140
            + RR  RRNRTTFT QQLE LE +F  THYPDVF REELA +I+LTEARVQVWFQNRRAK+RKT
Sbjct:   28 FLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKT 91          
The following BLAST results are available for this feature:
BLAST of TCONS_00001849-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DRGX8.712e-2876.56Dorsal root ganglia homeobox protein OS=Homo sapie... [more]
back to top