Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001840-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001840-protein
Unique NameTCONS_00001840-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1482

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001840-protein ID=TCONS_00001840-protein|Name=TCONS_00001840-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1482bp
MLPVKGNLLVLSLVVFCVAVNGLPFNAKYRFARDTAEELIPEEEGSGSGN
LYERDAIAQNASVLAAPVPGGHANATKEGAKDSKAASEKAEAKEEPKEKA
TKEQSKSFDDGQSLTSSEFANKPAADNKDVKEAPKVEEKKAQSKSDINEN
QAEDEVSEQQESPAEETSEEQPAQEGESEEEPSEEDGGNEEQQDNEENQE
DSNEEDSGNNEEEKKKDQVASNLKMFFISPYQKNGEEDPSTRQILTYPAK
SQGWGNTHQFGPSHIWNSDYPYFAYGYSWGCGHHGYGGIGHAKKSGVAKE
EDAQCRDYVLIPAAPQASAVLSPAENGVARNFVNKDIACNDGDTECTQRQ
VIGSMAGGSMFGDGMGGLGLGFPGVPGLHTGISGYNMAGGFGDHMGNGHG
GHHGGHRGAHGGGAGGGYAGGYGAHFFKAEEHGIPSYWNARADIPKGDVK
GFFGGRGAAFFHGEDILPIHEAANGIGSGSSYGVGSAQYWDKTPNFGAIH
SGFFGGRGGFGGYGGVGYGGRGGFGGYGGRGYGLGGLGANCGGTGCGGLG
LGGLGGGLGMGGLGGGCAGAGCGVGVAHAGLGAGCIGDGCGAGIGHAGAG
CVGDACGLGDGCVGDGCGAGLGAGLGAGLGAGLGAGCVGDGCGAGLGHGC
IGDGCVGELGHGGNCIGDGCGDGCLGDGCNGGHTAILSDGCGGDGCGGGW
SIGGHHGHGLVAKSKTKPSKKSKTTKKSKTAKATTRQDIAMPDEQAMMDV
TKQRQLIGSLGASTLFADNVGGMGLGHPGVPQMSSGVAGIPGEYGGSGGY
SHGWDGEGPGSHPHGYNNYAYSGGNHDYRSETPTPEEPAPANTDENAEKR
AIIYPNAEIDNGYSHNAVQYANGGFPGRATTQYTSVHHQSISHDDGDADG
YVDGGAGYVGGAAAAVPAVSAGYVTGGAVPAAGYLGGASVVGSRYAGSGY
LARSYHPRHVHVGVGTPGVKVEVETAKSVITSKPVHVTGQKMSEIKNIVK
DVTASLAKTSKKLKSLKTGAKRQITPAFTPVVSEPVGVPSNRYPVPAADR
YPLGAGYIWPSANYGHQYGGPYSWSKSHTPKAAPAVAAKPSTAKTSKKSN
TKKSSEKAKRSVSVKTPTVVVAKKGVNKKGSKRQFIQRGYGGMPIYGMGG
EGGEVMPSPRSFGYGGIRGYGSHHLMEGGFDGFGVPGGHMGYGHVGYGHH
GGYPMSVLSNHGDFGAGYAGPLGGNFDAGHHEYGVEGDIGFGGHGYGAGL
GGAGLGGAGLGGLGGHYGGRYAGHAGIFGGSFHHLGGPGIVGDYEGDRGA
LVMSDHAGFGAHGYGGPALLGGRVGFAGDHGYGYEGRAGLGYGHGFGGYG
HGIGYGHAGVMDGHLGYGHTSFDAGVHGGLGLDIGAHGIEGHSGYGGMHG
FVGLPHAAGAGFPGYARENIEQASEEQQQQQYAPSSRSMMPDPMYSNEQE
QYAPESQYEMQQRMQPEYMSAKKSSVPKKANH
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000973XLOC_000973Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001840TCONS_00001840Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01228EGGSHELLcoord: 688..706
score: 32.24
coord: 564..575
score: 55.21
coord: 659..669
score: 40.91
coord: 632..647
score: 52.34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1421..1482
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1083..1112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..735
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 65..218
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 805..846
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 131..896
e-value: 1.6E-6
score: 26.1

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001840-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top