Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001775-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001775-protein
Unique NameTCONS_00001775-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1178

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001775-protein ID=TCONS_00001775-protein|Name=TCONS_00001775-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1178bp
RSFKRNDEIKLEKNTENSTIKMYRTLAADDDSHSTKPIFSIEGIRESHVE
TNFTHHKSSRRTILICSIILISLTSLLATWVFVAKPHFYPSLHLAHRSDD
SLLMSSDEILGNNESGGGNEYTNIKMWHHRRSNGRHRGRRSVEAFDKSNL
DSESSLVKSEPDSNTVDTKTEDELRIRRDSSSHNTRFNYKNITDSKVDDI
PYNETRLPSHLIPVEYDLHFNVDLNEDNFTGETKIKLHCETQTDKIIFHG
RRFHPTNITVFSGRSIINIKRVSYIKRIEMFVVELESRLEEQSEYEVEIS
YTVDYGKNLAGLYKSYYEDFGIRKKMVSTHFEPTDARSAFPCLDEPFYKA
VFHISVEHESNLTALSNMPVKQSSTSHDNKNLTVFEPTVKMSTYLVAFSV
NEFKYSETSTPNGVKVRVYARHEDQERITYAVEAASKIIHFYGQFFNISY
PLPKLDLLAVPEFMAGAMEDWGLVSFRSAYIVFDEKLSTIEQKRQVTLVI
AHELAHQWFGNLVTMKWWNDIWLNEGFANYVELLGTDHVNPQFHSLDLEI
PQGWQGALSLDSMKSSHPVMQEAEKPSEIDELFDAISYNKGAALLRMVQG
FMGDQLEKGVIAYLQKYRYSNAETEDLLTSWSLTSHLNISSIMNSWINRR
SFPIVTVTRLNQTTFHLKQQSFLAAKNDIEQRELSGNLSVGGKNTTSVPY
SNSTSTKIARNMESRMEGSGNGTLQNSSKSTDDLLATKSHGSKQHSQGNG
TDDTIWSIPFTYITDEDNSEKLLWFNEKETTLEVPETTKWLKGNMQVNGY
YMVNYDNQTWNEIIQQLRANMSVFSANDRAGLIHDVFKLGCEKMIESILV
LDLVKYMSKEVDFIPFSMXKMIESILVLDLVKYMSKEVDFIPFSMLRSRA
ECLSTLVQDKKLKLKYMKYIWYLQSNLIIPQMVRDRSDVSQFTTFERMQR
FDTMSFGLKFNLSGELKNETRKVFDSLVSTNSSSDDISPENRALALMYGF
NPNSTDHLSYLWKLFKESPLDSDRRILMRSIPQFRSQINQTLEKSLNTSI
TRVQDSISLLASLVKNGFRKEVWDFFIKNYDVFHRRYGGGYQMGQLFGEV
AGGFTTQDMYKKVEKFLEDHPIGAKGSRSNMLVMEKIRNNINRHSNSTSN
THVANQIKDWLDKESNKTGNKRTLTLIG
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000952XLOC_000952Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001775TCONS_00001775Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR014782Peptidase_M1_N
IPR024571ERAP1-like_C_dom
IPR034016M1_APN-typ
Vocabulary: Molecular Function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008237 metallopeptidase activity
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014782Peptidase M1, membrane alanine aminopeptidase, N-terminalPRINTSPR00756ALADIPTASEcoord: 463..473
score: 70.13
coord: 337..352
score: 59.26
coord: 499..514
score: 80.92
coord: 385..400
score: 55.58
coord: 518..530
score: 66.07
IPR014782Peptidase M1, membrane alanine aminopeptidase, N-terminalPFAMPF01433Peptidase_M1coord: 412..646
e-value: 3.0E-80
score: 268.9
IPR024571ERAP1-like C-terminal domainPFAMPF11838ERAP1_Ccoord: 790..1121
e-value: 4.8E-32
score: 111.7
NoneNo IPR availableGENE3D2.60.40.1730coord: 197..403
e-value: 2.4E-52
score: 177.3
NoneNo IPR availableGENE3D1.10.390.10coord: 485..650
e-value: 8.2E-51
score: 171.9
NoneNo IPR availableSUPERFAMILY55486Metalloproteases ("zincins"), catalytic domaincoord: 409..657
NoneNo IPR availableSUPERFAMILY63737Leukotriene A4 hydrolase N-terminal domaincoord: 201..400
IPR034016Aminopeptidase N-typeCDDcd09601M1_APN_2coord: 214..653
e-value: 0.0
score: 569.504

Blast
BLAST of TCONS_00001775-protein vs. Swiss-Prot (Human)
Match: ERAP2 (Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens GN=ERAP2 PE=1 SV=2)

HSP 1 Score: 424.091 bits (1089), Expect = 5.936e-131
Identity = 291/954 (30.50%), Postives = 477/954 (50.00%), Query Frame = 0
Query:  201 PYNETRLPSHLIPVEYDLHFNVDLNEDNFTGETKIKLHCETQTDKIIFHGRRFHPTNITVFSGRSIINIKRVSYIKRI-----EMFVVELESRLEEQSEYEVEISYTVDYGKNLAGLYKSYYEDFGIRKKMVS-THFEPTDARSAFPCLDEPFYKAVFHISVEHESNLTALSNMPVKQSSTSHDNKNLTVFEPTVKMSTYLVAFSVNEFKYSETSTPNGVKVRVYARHEDQERITYAVEAASKIIHFYGQFFNISYPLPKLDLLAVPEFMAGAMEDWGLVSFRSAYIVFDEKLSTIEQKRQVTLVIAHELAHQWFGNLVTMKWWNDIWLNEGFANYVELLGTDHVNPQFHSLDLEIPQGWQGALSLDSMKSSHPVMQEAEKPSEIDELFDAISYNKGAALLRMVQGFMGDQ-LEKGVIAYLQKYRYSNAETEDLLTSWSLTSHLNISSIMNSWINRRSFPIVTVTRLNQTTFHLKQQSFLAAKNDIEQRELSGNLSVGGKNTTSVPYSNSTSTKIARNMESRMEGSGNGTLQNSSKSTDDLLATKSHGSKQHSQGNGTDDTIWSIPFTYITDEDNSEKLLWFNEKETTLEVPETTKWLKGNMQVNGYYMVNYDNQTWNEIIQQLRANMSVFSANDRAGLIHDVFKLGCEKMIESILVLDLVKYMSKEVDFIPFSMXKMIESILVLDLVKYMSKEVDFIPFSMLRSRAECLSTLVQDKKLKLKYMKYIWYLQSNLIIPQMVRDRSDVSQFTTFERMQRFDTMSFGLKFNLSGELKNETRKVFDSLVSTNSSSDDISPENRALALMYGFNPNSTDHLSYLWKLFKESPLDSDRRILMRSIPQFRSQ--INQTLEKSLNTSITRVQDSISLLASLVKNGFRKEV-WDFFIKNYDVFHRRYG-GGYQMGQLFGEVAGGFTTQDMYKKVEKFLEDHPIGAKGSRSNML--VMEKIRNNI 1141
            P+ E RLPS +IP+ YDL  + +L   +F    KI++     T  II H +    TN T+ S      +K    +K +     E   + +  +L    +Y V + +    G    G YKS Y   G   ++++ T FEPT AR AFPC DEP +KA F I +  ES   ALSNMP  ++           FE TVKMSTYLVA+ V +F      T +GVKV +YA  + + +  YA++A+ K++ FY ++F+I YPL KLDL+A+P+F  GAME+WGL+++R   ++FD K S+   K  VT VIAHELAHQWFGNLVTM+WWNDIWL EGFA Y+EL+  +   P+    D  +   ++  ++ DS+ SS P+ + AE P++I E+FD +SYNKGA +L M++ F+G++  +KG+I YL+K+ Y NA+ +DL   WS  S+  + S   S     S P +T   L          +FL    ++++   +  L  G      +P        + +     +       LQ   +   +  A +             +  +W IP TY T   N         K  TL++PE T W+K N+  NGYY+V+Y+   W+++I QL  N ++    DR GLIHDVF+L     +     LD+  Y+  E      S   ++E +  L+   +M            R+ ++    L   K+  L+Y K +       I  Q   D+  V     ++RM R   +      N +  ++ +  ++F   +    SS  ++     L ++Y     +T   +YL + ++ S   +++  ++ ++   + Q  + + +E  +   + + Q+  +LL ++ +    +++ WDF  +N+    +++  G Y +  +       F+++D  ++V+ F E   + A+GS  ++   V+E I  NI
Sbjct:   63 PWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFYKSTYRTLGGETRILAVTDFEPTQARMAFPCFDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSLSGFTSSGVKVSIYASPDKRNQTHYALQASLKLLDFYEKYFDIYYPLSKLDLIAIPDFAPGAMENWGLITYRETSLLFDPKTSSASDKLWVTRVIAHELAHQWFGNLVTMEWWNDIWLKEGFAKYMELIAVNATYPELQFDDYFLNVCFE-VITKDSLNSSRPISKPAETPTQIQEMFDEVSYNKGACILNMLKDFLGEEKFQKGIIQYLKKFSYRNAKNDDL---WSSLSNSCLESDFTSGGVCHSDPKMTSNML----------AFLGENAEVKEMMTTWTLQKG------IP------LLVVKQDGCSLRLQQERFLQGVFQEDPEWRALQ-------------ERYLWHIPLTYSTSSSNVIHRHILKSKTDTLDLPEKTSWVKFNVDSNGYYIVHYEGHGWDQLITQLNQNHTLLRPKDRVGLIHDVFQLVGAGRLTLDKALDMTYYLQHET-----SSPALLEGLSYLESFYHMMDR---------RNISDISENL---KRYLLQYFKPV-------IDRQSWSDKGSV-----WDRMLRSALLKLACDLNHAPCIQ-KAAELFSQWM---ESSGKLNIPTDVLKIVYSVGAQTTAGWNYLLEQYELSMSSAEQNKILYALSTSKHQEKLLKLIELGMEGKVIKTQNLAALLHAIARRPKGQQLAWDFVRENWTHLLKKFDLGSYDIRMIISGTTAHFSSKDKLQEVKLFFES--LEAQGSHLDIFQTVLETITKNI 942          
The following BLAST results are available for this feature:
BLAST of TCONS_00001775-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ERAP25.936e-13130.50Endoplasmic reticulum aminopeptidase 2 OS=Homo sap... [more]
back to top