Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001773-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001773-protein
Unique NameTCONS_00001773-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length314

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001773-protein ID=TCONS_00001773-protein|Name=TCONS_00001773-protein|organism=Clytia hemisphaerica|type=polypeptide|length=314bp
MAEPPAKKARAAESESCDNLLDGFETVKILMNDVKAKKVHVLGKFKDSDE
NAIVSLSKTPFTEDSVKSILSKETNLKKEFNNDIYGQFIAETSPSLNTLA
TNTIHPATEKHIMKYTSQDIHLVNETAEDYQNITLPYLEKQQFSINWVYN
ILDHEKEADRILYEDPDKENGFIILPDLKWDGKQIEDLYLTGICHARGIK
SIRDLNSSHLPMLKNMLSKGMEVIKKTYNVPSNQIRAYFHYFPSYYHLHV
HFVHLKNDVGGIYVGKAHLVSDVIDNIERFGDDFYAKKTLPVTLREKDTL
LKLLLEVKEEKPSS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000950XLOC_000950Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001773TCONS_00001773Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR011146HIT-like
IPR008594DcpS/DCS2
IPR011145Scavenger_mRNA_decap_enz_N
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0016787hydrolase activity
Vocabulary: Biological Process
TermDefinition
GO:0000290deadenylation-dependent decapping of nuclear-transcribed mRNA
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016787 hydrolase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011146HIT-like domainGENE3D3.30.428.10coord: 146..245
e-value: 7.0E-11
score: 42.0
IPR011146HIT-like domainSUPERFAMILY54197HIT-likecoord: 118..305
NoneNo IPR availablePFAMPF11969DcpS_Ccoord: 146..259
e-value: 1.0E-32
score: 112.9
NoneNo IPR availableGENE3D3.30.2240.10coord: 246..307
e-value: 6.3E-24
score: 83.7
IPR008594Scavenger mRNA decapping enzyme DcpS/DCS2PIRSFPIRSF028973DcpScoord: 6..313
e-value: 5.7E-109
score: 361.6
IPR008594Scavenger mRNA decapping enzyme DcpS/DCS2PFAMPF05652DcpScoord: 20..118
e-value: 7.1E-21
score: 74.9
IPR011145Scavenger mRNA decapping enzyme, N-terminalSUPERFAMILY102860mRNA decapping enzyme DcpS N-terminal domaincoord: 18..118

Blast
BLAST of TCONS_00001773-protein vs. Swiss-Prot (Human)
Match: DCPS (m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1 SV=2)

HSP 1 Score: 283.878 bits (725), Expect = 8.399e-95
Identity = 134/292 (45.89%), Postives = 191/292 (65.41%), Query Frame = 0
Query:   23 GFETVKILMNDVKAKKVHVLGKFKDSD-----ENAIVSLSKTPFTEDSVKSILSKETNLKKEFNNDIYGQFIAETSPSLNTLATNTIHPATEKHIMKYTSQDIHLVNETAEDYQNITLPYLEKQQFSINWVYNILDHEKEADRILYEDPDKENGFIILPDLKWDGKQIEDLYLTGICHARGIKSIRDLNSSHLPMLKNMLSKGMEVIKKTYNVPSNQIRAYFHYFPSYYHLHVHFVHLKNDVGGIYVGKAHLVSDVIDNIERFGDDFYAKKTLPVTLREKDTLLKLLLEVKE 309
            GF   K+L    + K + + GK  ++      E+A+V L KTPF  + V  +L+    L+ +F+NDIY  +       LN + T  ++PATEKH+ KY  QD+ L+ ET +DY+NITLP+LE Q  SI WVYNILD + EADRI++E+PD  +GF+++PDLKW+ +Q++DLYL  ICH RGI+S+RDL   HLP+L+N+L +G E I + Y +  + +R Y HY PSYYHLHVHF  L  +  G  V +AHL+++VI+N+E      Y ++TL   LR  D LLKLL E ++
Sbjct:   46 GFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAEVIENLE-CDPRHYQQRTLTFALRADDPLLKLLQEAQQ 336          
The following BLAST results are available for this feature:
BLAST of TCONS_00001773-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DCPS8.399e-9545.89m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1... [more]
back to top