Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001756-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001756-protein
Unique NameTCONS_00001756-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length257

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001756-protein ID=TCONS_00001756-protein|Name=TCONS_00001756-protein|organism=Clytia hemisphaerica|type=polypeptide|length=257bp
MTNLCITAASFLLSSLFVVQSSPVQLNGDPCQRDGPEYWCRNQQTATECG
VLNFCKKRGFNSAITNNVVKPLQFELYFESLCPDCRNFFKEQLWPAYQQL
YDTGIFDITLYSYGNANEKKEGDNWVFTCQHGAEECQLNLLETCVLHMLT
HPKQFMPYINCVELDPSLARAKHCADEMRIEWQPIFKCYNGSEGNFLEHQ
VAVKTDSLEPKHTWVPWIVLDGAHTKEIQDAATTNLSKLLCEQYKGTTPD
TCNDIIR
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000941XLOC_000941Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001756TCONS_00001756Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003119SAP_A
IPR004911Interferon-induced_GILT
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003119Saposin A-type domainPFAMPF02199SapAcoord: 35..57
e-value: 1.0E-8
score: 35.1
IPR003119Saposin A-type domainPROSITEPS51110SAP_Acoord: 25..65
score: 9.053
NoneNo IPR availableGENE3D3.40.30.10coord: 60..251
e-value: 3.0E-4
score: 20.2
IPR004911Gamma interferon inducible lysosomal thiol reductase GILTPFAMPF03227GILTcoord: 74..177
e-value: 1.4E-30
score: 105.5

Blast
BLAST of TCONS_00001756-protein vs. Swiss-Prot (Human)
Match: GILT (Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens GN=IFI30 PE=1 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 1.460e-30
Identity = 65/179 (36.31%), Postives = 91/179 (50.84%), Query Frame = 0
Query:   76 LYFESLCPDCRNFFKEQLWPAYQQLYDTGIFDITLYSYGNANEKKEGDNWVFTCQHGAEECQLNLLETCVLHMLTHPKQFMPYINCVELDPSLARAKHCADEMRIEWQP--IFKCYNGSEGNFLEHQVAVKTDSLEPKHTWVPWIVLDGAHTKEIQDAATTNLSKLLCEQYKGTTPDTC 252
            LY+E+LC  CR F   +L+P +  L    I ++TL  YGNA E+     W F CQHG EEC+ N +E CVL  L     F+  +   E +        C         P  I +C  G  G  L H  A +TD+L+P H +VPW+ ++G   K ++D   T L  L+C+ Y+G  PD C
Sbjct:   66 LYYEALCGGCRAFLIRELFPTW--LLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNG---KPLED--QTQLLTLVCQLYQGKKPDVC 237          
The following BLAST results are available for this feature:
BLAST of TCONS_00001756-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GILT1.460e-3036.31Gamma-interferon-inducible lysosomal thiol reducta... [more]
back to top