Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001711-protein ID=TCONS_00001711-protein|Name=TCONS_00001711-protein|organism=Clytia hemisphaerica|type=polypeptide|length=160bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001711-protein vs. Swiss-Prot (Human)
Match: LSM10 (U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens GN=LSM10 PE=1 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 4.595e-24 Identity = 43/111 (38.74%), Postives = 70/111 (63.06%), Query Frame = 0 Query: 19 LSLSGKERAKTEQTLICLIRGCIGNQTVVELRNETIVCGRILNCDGFMNLIMQKALFQKANGEELYFEEVHIVAKNIRYVHIPDKIDIQNTIEKQLFKLGKTRQTGSTSRG 129 +S S KER +E +LI L++G G T V+LR+E++ GRI N D FMN+ + K + G ++ +++ + +N+RYVHIPD ++I +TIE+QL + + R G +G Sbjct: 3 VSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQG 113 The following BLAST results are available for this feature:
BLAST of TCONS_00001711-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|