Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001678-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001678-protein
Unique NameTCONS_00001678-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1011

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001678-protein ID=TCONS_00001678-protein|Name=TCONS_00001678-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1011bp
MILPSIIHPNALSQVLTALIEMLELAHPXLDNSPERPFTSPDRPHRNART
SPSYNSHHIGQSYMTPPSHIGRTYPAHPDDFLPPNEFNHRMSSTYRREEP
FRTKSEPFLPVGREFEKSSIHREESGKTFTNQPSIHDLLLNNSVNAQNTD
LSDITILPQLLGVSQNGQLVLVPLAASVNLNSSLNNTFDGLNGAKQRASP
VGQNSESVNQTFDDSQQTVKTNGSVTQNVSVLQQRQNNDHPNSGSFNDRI
KAERESQRLNYIELKRLEKEKAKRLQEEEKDLKLQEEKQRWRDLENEIER
KKVEEERLKAEKLAQEKKEKEQKQRDKEQEKLLKPQESPALKKQKSPMFS
KLKSLAKFSPSTRRDSKQEAPAVVVEEIAKEPSKEEMQENEPPSFFGDDE
DLFPDDDSEDENDLRLHSKSMSRAISDIEELSENSSRQTPKKKSPIQSPR
SSSEPLKSSSTPQSRQQQPQIQEPSPLVSPLNNNHSSSANDSLTNHPRSN
KESPPSANHSKTNKDSSLFSDFSDHSEFDLPSNKSVSPPQTKSSPPLTLS
VVAKQPARSPPVPALQKQRTFSQDSHGETMDDYQPLLYIMETLTDKVKDE
ESEEVLVLNIDINTNQANTIIGTAELEGNVKQFDSSELCMSYRYHLQQLM
VKKSDRPFLIHDVDANNDFEGNLRDCVDSCYLEIWDSLFIFLTEIMSAFE
FDPVQVATIFANVLLPSHEKQRKQVLSSLGKILTHLSEESFETENEDGES
EAGPIATNNVSMPTHSNISITEEIHTRGISKTSKSEPLSSTYGGGKSTTE
KGDLSQSLSFENEDENSSTLSFDSDGLPVRRSKQTNKQQDSISQNNSTLS
EASSNLNLNGSKAYQEMRHESLMSPVHESVDDDDELEDLLGESIGLNKRP
QKMTSSPPPPAAPYSTENNNSTNDQLSKKSSIKMTPSSDLITRSESSLTS
QTKNKNQKKMDVKKPDFWDTESESDFDLSNAGRSGNQSSQQQQQGKKDDD
DDDDFDFDFYD
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000872XLOC_000872Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001678TCONS_00001678Clytia hemisphaericatranscript
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 261..333

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001678-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top