Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001660-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001660-protein
Unique NameTCONS_00001660-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length421

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001660-protein ID=TCONS_00001660-protein|Name=TCONS_00001660-protein|organism=Clytia hemisphaerica|type=polypeptide|length=421bp
MASHYLHYQSNPKPNMASIPRPFFRSFKDLGRTWFKRTRPRTFEGKPNFE
FTIASYNVLADKLLHDHPHLYFNRGNRDSWIFDWNYRKKNLIAEIIYSNA
DILCLQEVQEEHFYNWFNPKLKECGYTGIYNKRSGNKEDGCATFFKHDIF
CMERHELVSFNKPKSNFMNRDNVAILVVLQPRAEIFKTNTPICVGNTHLL
FNTKRGDIKLAQLAHLFAEVDRLSTDCRSNLPVILCGDFNSTPFSPLYDF
LIRGELKFDGISRTVISGQDGSAKNENNYVLRDNVFPPDLGLTHTCKWRD
SAQKQNGVNNIIDLTSDNDDYQTYLKEERGILKHDLELNSCYMHRGLDGS
REVTTCHDKACSTVDYILYSNGKKKDSGGHSLWVSGVMSLLSEHEVYNMG
KLPNKNLSSDHLMLMSSFVMS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000866XLOC_000866Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001660TCONS_00001660Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR005135Endo/exonuclease/phosphatase
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005135Endonuclease/exonuclease/phosphatasePFAMPF03372Exo_endo_phoscoord: 54..411
e-value: 3.8E-22
score: 78.9
IPR005135Endonuclease/exonuclease/phosphataseGENE3D3.60.10.10coord: 45..421
e-value: 3.6E-53
score: 180.2
IPR005135Endonuclease/exonuclease/phosphataseSUPERFAMILY56219DNase I-likecoord: 38..251
coord: 332..420

Blast
BLAST of TCONS_00001660-protein vs. Swiss-Prot (Human)
Match: ANGE2 (Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 2.887e-80
Identity = 155/405 (38.27%), Postives = 234/405 (57.78%), Query Frame = 0
Query:   36 KRTRPRTFEGKPNFEFTIASYNVLADKLLHDHPHLYFNRGNRDSWIFDWNYRKKNLIAEIIYSNADILCLQEVQEEHFYNWFNPKLKECGYTGIYNKRSGNKEDGCATFFKHDIFCMERHELVSFNKPKSNFMNRDNVAILVVLQPRAEIFKTNTPICVGNTHLLFNTKRGDIKLAQLAHLFAEVDRLSTDCRSNL-PVILCGDFNSTPFSPLYDFLIRGELKFDGISRTVISGQDGSAKNENNYVLRDNVFPPDLGLTHTCKWRDSAQKQNGVNNIIDLTSDNDDYQTYLKEERGI---------LKHDLELNSCYMHRGLD-GSREVTTCHDKACSTVDYILYSNGKKKDSGGHS----LWVSG-----VMSLLSEHEVYNMGKLPNKNLSSDHLMLMSSFVM 420
            K   P+  + +  F+F++ SYN+L+  LL D+ HLY  R  R   +  W++R  N++ EI + +AD+LCLQEVQE+H+     P L+  GY   Y  R+G K DGCA  FKH  F +     V F +P  + ++RDNV ++++LQP+   +     ICV NTHLL+N +RGDIKL QLA L AE+  ++     +  P+++CGDFNS P SPLY F+  G+L ++G+    +SGQ+ S++ +   +L   ++PP+LG++  C +    Q+   V       +D+D  QT LK+   +         L+H   L+S Y H   D G  EVTTCH ++  TVDYI YS  +K+D  GH       V G      +SLL+E +++ +  LPN+N SSDHL L++ F +
Sbjct:  152 KNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLY--RHCRRP-VLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIP-YAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQR--ILSIPIWPPNLGISQNCVYE--VQQVPKVEK-----TDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVYSHYFPDTGIPEVTTCHSRSAITVDYIFYS-AEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRL 542          
The following BLAST results are available for this feature:
BLAST of TCONS_00001660-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANGE22.887e-8038.27Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 ... [more]
back to top