Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001642-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001642-protein
Unique NameTCONS_00001642-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1484

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001642-protein ID=TCONS_00001642-protein|Name=TCONS_00001642-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1484bp
MSNRLKKKNSPTSLSFSVDVVHLLQKELSELDLSEDVCNQFKGIIACPSN
GKDQLLLLKKVLKELKQNEDVLQNTLKILCCFFVYCKSKHPLRRTLSSFL
SGIPKEYDVIFHKVMNQLINETLHNSSKCHSSELIGTQDKEKCEMVASLM
ENFVKGDQVIQNNANTVLAFLCSSLKLFTQMARNNDGPVIQTQMIHNCLF
TLKTIISVLQKCENPTLPQSLNENLVLQIAQAASEIVADESFLIECRNAA
AMVFPAILLHFSRFIENLLVNLSSETFSPPGHTLVDFIISTVVEFIKNMK
SMSCVVVTLHAVVVKLPNYLLVSSKKCTVDLFFLSLQKICCNCTDKNTMI
LSFKTFCLWVTTIISKNIDVAVITDSAIPFLITNVDHGIDTVRHSVTASL
KECLGYLLKSNKRSIVEELTQKYVTNDFKSRGKLNVLSSLCEISSMKSVL
STRLTFPKDLLELLGDVDLASHATNVYKTASKKHLEELQSRNESLSKWNK
TWISGISVGLMSDCKDTKANMVNYIVPAMLKINPLVLNYLLSEFNVNSSM
VEFYTAVVFLKTARGMKNVSQEIFKIKSSSGEGHIWNGLMNFDLLKKCIV
HIDDQVRLDVLSLVCSSVKTTDHVSEDDIELIKVFLQYNMAVENPSFRQQ
TVVCFKKLVTRIFAHTYQITKSRSPNKTQIVQLYSDFIVWFIAHVFNNLY
LDAPYCQMSTTLELISLITTFLGENISSDVTKSLLIDDVIKQTYTTKLLN
CLHDTYDPNRLLVLSIFSKKPLFTIEFSQEKLLSLGDTAIQNLYSPQPDI
SSVAAYQLCFLSFSENVGDTAKDRYPCLTMLKNLFQHLLKQVSIMKMSLL
KASQDAPIHGTLFAIRLLXLKASQDAPIHGTLFAIRLLFQTHQWNLNHST
VKSNREDFNQFVNEFTKLGFDIIELVSPYVTNEAPEGQLCNVNLSDIFEL
LSVHGGDTVLQAHVARMILVCCWRSMKEVSLILGLFISHFVDPSSQDSLL
SNEMFLDMWDMFNNIMLRSKHAGAYELASIGFLKLCTTLWISRDESLRTL
PLNAVQDLIADLTSSEPMENAQVTRRSAGLPFYLQSLCSTEPEINGKASF
SFLMSSLSELCLDHLQTHDINKTVIALNVLRAFYKDAKMCEDVFPYVAKG
IMIALNGFGSSLWPIRNSCTLLFSSLMQRIFGVKKVKMTGREFFSRYPQL
YPYLVEKTKLMSVTNESNTQLHPSVFPILLLLSHLYPSTIEGADSLMKLD
VFLESILSLSGNPVYKTRTMTANALVPLVSLERAESVTKRILGDIKRHYE
GTINQNAIHGCLLQLFRLIKKWASLPLRQVNVVFLMKLVLKESVGLFNDS
NVNPISKKCLLDIVILLLQTNTGFNDAESNSIIEAYAKTGVLLLISHKKK
DINENTSAGYALLLRGVTAFIMELLKAELLASNLVKLFNAKDTTVKSVVD
VFLYLLGLRHADVVGEITARKDDVKLSSFEGLAS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000856XLOC_000856Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001642TCONS_00001642Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR019442DUF2428_death-receptor-like
IPR011989ARM-like
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 55..75
IPR019442Domain of unknown function DUF2428, death-receptor-likePFAMPF10350DUF2428coord: 911..1163
e-value: 9.2E-55
score: 185.7
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 9..838
e-value: 2.4E-5
score: 22.2

Blast
BLAST of TCONS_00001642-protein vs. Swiss-Prot (Human)
Match: THADA (Thyroid adenoma-associated protein OS=Homo sapiens GN=THADA PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.095e-108
Identity = 368/1430 (25.73%), Postives = 667/1430 (46.64%), Query Frame = 0
Query:   49 SNGKDQLLLLKKVLKELKQNED------VLQNTLKILCCFFVYCKSKHPLRRTLSSFLSGIPKEY-DVIFHKVMNQLINETLHNSSKCHSSELIGTQDKEKCEMVASLMENFVKGDQVIQNNANTVLAFLCSSLKLFTQMARNNDG-PVIQTQMIHNCLFTLKTIISVLQKCEN------PTLPQSLNENLVLQIAQAASEIVADESFLIECRNA---AAMVFPAILLHFSRFIENLLVNLSSETFSPPGHTLVDFIISTVVE-FIKNMKSMSCVVVTLHAVVVKLPNYLLV----------SSKKCTVD----LFFLS-----------LQKICCNCTDKNTMILSFKTFCLWVTTIISKNIDVAVITDSAIPFLITNVDHGIDTVRHSVTASLKECLG-YLLKSNKRSIVE-----ELTQKYVTNDFKSRGKLNVLSSLCEISSMKSVLSTRLTFPKDLLELLGDVDLASHATNVYKTASKKHLEELQSRNES---LSKWNKTWISGISVGLMSDCKDTKANMVNYIVPAMLKINPLVLNYLL----SEFNVNSSMVEFYTAVVFLKTARGMKNVSQEIFKIKSSSGEGHI------WNGLMNFDLLKKCIVHIDDQVRLDVLSLVCSSVKTTDHVSEDDIELIKVFLQYNMAVENPSFRQQTVVCFKKLVTRIFAHT---YQITKSRSPNKTQ----------IVQLYSDFIVWFIAHVFNNLYLDAPYCQMSTTLELISLITTFLGENISSDVTKSLLIDDVIKQTYTTKLLNCLHDTYDPNRLLVLSIFSKKPLFTIEFSQE-KLLSLGDTAIQNLYSPQPDISSVAAYQLCFLSF------------SENVGDTAKDRYPC------LTMLKNLFQHLLKQVSIMKMSLLKASQDAPIHGTLFAIRLLXLKASQDAPIHGTLFAIRLLFQTHQWNLNHSTVKSNREDFNQFVNEFTKLGFDIIELVSPYVTNEAPEG-------------------QLCNVNLSDIF---ELLSVHG---------------------GDTVLQAHV-ARMILVCCWRSMKEVSLILGLFISHFVD---PSSQDSLLSNEMFLDMWDMFNNIMLRSKHAGAYELASIGFLKLCTTLWISRDESLRTLPLNAVQDLIADLTSSEPMENAQVTRRSAGLPFYLQSLCSTEPEINGKASFSFLMSSLSELCLDHLQTHDINKTVI---ALNVLRAFYKDAKMCEDVFPYVAKGIMIALNGFGSSLWPIRNSCTLLFSSLMQRIFGVKKVK--------MTGREFFSRYPQLYPYLVEKTKLMSVTNESN---TQLHPSVFPILLLLSHLYPSTIEGADSLMKLDVFLESILSLSGNPVYKTRTMTANALVPLVSLERAESVTKRILGDIKRHYEGTINQNAIHGCLLQLFRLIKKWA 1323
            ++G  Q+  +K+++  L++ +        +Q+ L IL   ++    K+PL++ L+S L+ +P  +     H+  ++L  E   N++  +S        ++  + ++S MENF  G   + N    VL FL  SL    +  R   G  +IQTQ++++ L  ++  + ++QK ++       T    + +N+   +    +++++D+  L   ++    A ++F   + H S  I +L+ ++           L     ++V E F+ + +S+ C  ++  AV+      L +          S +   +D    LF LS           L +I  + T+    +L   +  L  T  ++ N   + I    + ++ T+ +H +D +RH      K  L  + L       V      ELT+  +  ++  +GK   L  L E   ++ +L+   T P  +LE++GD  L  +A+++ +T  + H   L+S+      + +W++TW+S +   L     D K+ +++Y +P +L  +P  L Y++    +  +  +   + + ++    + RG         +I  +   GH+      W  L++   +K+ ++H   QVR+D L L+C S ++T+ VS ++++ I+ F+ YN+  ++P  RQQ     KKL  RI   +   Y++ +S+S  + +           +Q Y +F+      +F  L+  + Y    + L ++  I            T   L  D+    + T L+ C   T++  ++L   +  K     + F    KL  L   A++   S +P     A+Y L FL +            ++ V     DR         L ++K L ++L ++VS  + SLL+A+   P++G +  I     K S        L +++L+                  ++   V +   + + +  +VSP + + +PEG                   ++   + +D F   ++L  H                      G  V    V A+M+LVCCWRSMKEV+L+LG+          P S D LL+ E   ++ D F   +L+S+H GA+ELA  GF+KL   L    + SL+ LP   +  ++ ++  S+P      TRRSAG+PFY+Q+L ++EP+   K     L  ++ EL      T DI  TV    ALN+LRA ++D ++ E++ PYVA G   A+ GF S +W +RNS TLLFS+L+ RIFGVK+ K        MTGREFFSR+P+LYP+L+++ + ++ T +S+      HPS+F +LL+L  LY S ++G  S + +  F+  I+    +PVY +R M A ALVP V ++   +  + +L  +    +    QN IHG LLQ+F L++ ++
Sbjct:   46 TDGVSQIHYIKQIVPLLEKADKNGMCDPTIQSCLDILAGIYLSLSLKNPLKKVLASSLNSLPDFFLPEAMHRFTSRLQEEL--NTTDLYSY-------RKVTDNISSCMENFNLGRASVNNLLKNVLHFLQKSLIEILEENRKCAGNHIIQTQLMNDLLVGIRVSMMLVQKVQDFQGNLWKTSDSPIWQNMC-GLLSIFTKVLSDDDLLQTVQSTSGLAIILFIKTMFHPSEKIPHLISSV----------LLRSVDCTSVPEWFMSSCRSLCCGDISQSAVLFLCQGTLAMLDWQNGSMGRSGEALLLDTAHVLFTLSSQIKEPTLEMFLSRILASWTNSAIQVLESSSPSL--TDSLNGN---SSIVGRLLEYVYTHWEHPLDALRHQTKIMFKNLLQMHRLTVEGADFVPDPFFVELTESLLRLEWHIKGKYTCLGCLVECIGVEHILAIDKTIPSQILEVMGDQSLVPYASDLLETMFRNHKSHLKSQTAESSWIDQWHETWVSPLLFILCEGNLDQKSYVIDYYLPKLLSYSPESLQYMVKILQTSIDAKTGQEQSFPSLGSCNS-RGALGALMACLRI--ARAHGHLQSATDTWENLVSDARIKQGLIHQHCQVRIDTLGLLCESNRSTEIVSMEEMQWIQFFITYNLNSQSPGVRQQICSLLKKLFCRIQESSQVLYKLEQSKSKREPENELTKQHPSVSLQQYKNFMSSICNSLFEALFPGSSYSTRFSALTILGSIAEVFHVPEGRIYTVYQLSHDIDVGRFQT-LMECFTSTFEDVKILAFDLLMKLSKTAVHFQDSGKLQGLFQAALELSTSTKPYDCVTASYLLNFLIWQDALPSSLSAYLTQQVACDNGDRPAAVVERNTLMVIKCLMENLEEEVSQAENSLLQAAAAFPMYGRVHCITGALQKLS--------LNSLQLV-----------------SEWRPVVEKLLLMSYRLSTVVSPVIQSSSPEGLIPMDTDSESASRLQMILNEIQPRDTNDYFNQAKILKEHDSFDMKDLNASVVNIDTSTEIKGKEVKTCDVTAQMVLVCCWRSMKEVALLLGMLCQLLPMQPVPESSDGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATRRSAGIPFYIQALLASEPK---KGRMDLLKITMKELISLAGPTDDIQSTVPQVHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWAVRNSSTLLFSALITRIFGVKRAKDEHSKTNRMTGREFFSRFPELYPFLLKQLETVANTVDSDMGEPNRHPSMFLLLLVLERLYASPMDGTSSALSMGPFVPFIMRCGHSPVYHSREMAARALVPFVMIDHIPNTIRTLLSTLPSCTDQCFRQNHIHGTLLQVFHLLQAYS 1418          
The following BLAST results are available for this feature:
BLAST of TCONS_00001642-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
THADA2.095e-10825.73Thyroid adenoma-associated protein OS=Homo sapiens... [more]
back to top