Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001640-protein ID=TCONS_00001640-protein|Name=TCONS_00001640-protein|organism=Clytia hemisphaerica|type=polypeptide|length=101bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001640-protein vs. Swiss-Prot (Human)
Match: GLRX2 (Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 1.986e-25 Identity = 42/91 (46.15%), Postives = 58/91 (63.74%), Query Frame = 0 Query: 10 VEEAIAKDKVVVFSKTYCPYCKMAKGSLDKVGAKYVVIELDNRNDGGAIQDALAEITGARTVPRVFISGKCIGGGSETQNLEKSGQLATMV 100 ++E I+ + VV+FSKT C YC MAK + Y V+ELD G QDAL ++TG RTVPR+F++G IGG ++T L K G+L +V Sbjct: 60 IQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLV 150 The following BLAST results are available for this feature:
BLAST of TCONS_00001640-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|