Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001629-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001629-protein
Unique NameTCONS_00001629-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length501

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001629-protein ID=TCONS_00001629-protein|Name=TCONS_00001629-protein|organism=Clytia hemisphaerica|type=polypeptide|length=501bp
MIATTKHGKERAKLRRMSSFSASLDYDNEDEALYKEIFYIENGSQSNIYC
NTTIRYPSETQERFLVGTLNGNVSCLERFKDVTAKEKFHSSHSMDAYEVC
FAYIPAGAEIISMDAFYQKGFFDSYDCLIVGITIIIKKPDGESLHFLNVY
NAIEPVKEFEIDKLAQVCQHLPLGFIPYQLRHTRIHINGRSEKVFLLAGG
DQQIHVFRSNDKQNFEEVACGKFFPEFVNLPGVVLWMDIKNFANMRLSAV
GCDNGQLLVCSTNTEENRVMESWTLSLDGPISTVRFFSLSKNKRKEKLSS
TSGSDISESEDEKLHLLVTSCLEVSVVFVDILNKGLDDMSVLNQSDQFDS
VTCSCVADIDFDGNNEIILGTYGQELLVYKWSAADNGLSDHIRFDLMWSR
SFSKPLLSIRDLDLMNDGMQELVIVSLTGVHILQQNVSMAAETLLDILIK
AFPDQKSITTFNEKFNNRHIPEHDKDKSDHEELEGLIEAMCSTDNSYNEV
T
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000847XLOC_000847Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001629TCONS_00001629Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 21..279
e-value: 3.5E-4
score: 19.3
coord: 280..433
e-value: 1.2E-4
score: 20.8
NoneNo IPR availableSUPERFAMILY69318Integrin alpha N-terminal domaincoord: 203..287
coord: 314..426

Blast
BLAST of TCONS_00001629-protein vs. Swiss-Prot (Human)
Match: KPTN (KICSTOR complex protein kaptin OS=Homo sapiens GN=KPTN PE=1 SV=2)

HSP 1 Score: 281.567 bits (719), Expect = 7.491e-90
Identity = 169/413 (40.92%), Postives = 232/413 (56.17%), Query Frame = 0
Query:   44 SQSNIYCNTTIRYPSETQERFLVGTLNGNVSCLERFKDVTAKEKFHSSHSMDAYEVCFAYIPAGAEIISMDAFYQKGFFDSYDCLIVGITIIIKKPDGESLHFLNVYNAIEPVKEFEIDKLAQVCQHLPLGFIPYQLRHTRIHINGRSEKVFLLAGGDQQIHVFRSNDK-QNFEEVACGKFFPEFVNLPGVVLWMDIKNFANM--RLSAVGCDNGQLLVCSTNTEENRVMESWTLSLDGPISTVRFFSLSKNKRKEKLSSTSGSDISESEDEKLH----LLVTSCLEVSVVFVDILNKGLDDMSVLNQSDQFDSVTCSCVADIDFDGNNEIILGTYGQELLVYKWSAADNGLSDHIR-FDLMWSRSFSKPLLSIRDLDLMNDGMQELVIVSLTGVHILQQNVSMAAETLLDIL 448
            SQSN+Y        +  +   L  TL G V    R++D+  K +        A E+ F YIP  AEI+S+D F +         L+VGIT I    D  S  FLN+Y   EP  E+ +D +AQ C +L L F P+QL H  + +  + E VFLL+G D  IH+++ N+    FEE      FPE  NL   VLW+D+ NF     RLSA+GC +G + V   +     V++ W++  DGPIS V  FSLS  K              E++D  L     +LV S LE +VV+ D+LN+GL+D  +L  SDQFDSV CS V D+D DG  E+++ TYGQELL YK+   ++GL +    F L+W RSFS PLL++  +DL  DG+QEL +VSL GVHILQ ++  A+E +L  L
Sbjct:   24 SQSNVYGLAGG---AGGRGELLAATLKGKVLGF-RYQDLRQKIR------PVAKELQFNYIPVDAEIVSIDTFNKS---PPKRGLVVGITFIKDSGDKGS-PFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAK--------------ETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRL 408          
The following BLAST results are available for this feature:
BLAST of TCONS_00001629-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KPTN7.491e-9040.92KICSTOR complex protein kaptin OS=Homo sapiens GN=... [more]
back to top