Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001627-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001627-protein
Unique NameTCONS_00001627-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length355

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001627-protein ID=TCONS_00001627-protein|Name=TCONS_00001627-protein|organism=Clytia hemisphaerica|type=polypeptide|length=355bp
VGMKIKVAISFTGKFEMENRIELERRGQEKKEITELNLDNTRSTSIVGLT
DEYSNLEYLSLINVGLTTLKGLPGLEKLKKLELSDNRISTGLDYLLKLPG
LAYLSLSGNRIKDFESLSPLAKLSNLKSLDLFNCEVTCEKDYRAKVFELI
PQLKFLDGADRDDKEMEESESEGEEDEEDDDDEEGEDEDGVENGVTEDDD
DEDEDTEIVGIDDEDDDELEEEELDEDADGGLEEIVDGGEDENEEDDEDD
DDDEEEVVITAENDGLIDREEEEEDDDDDDDDDELEESDEDEELGLDYLT
KENLSEEDEDEEDFNPEEVDDEEEELSEEEEEIMEEQRGVKRKHEGDHSR
ADEES
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000846XLOC_000846Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001627TCONS_00001627Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR032675L_dom-like
IPR001611Leu-rich_rpt
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 319..339
NoneNo IPR availablePFAMPF14580LRR_9coord: 35..168
e-value: 3.7E-15
score: 55.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..355
NoneNo IPR availableSUPERFAMILY52075Outer arm dynein light chain 1coord: 31..169
IPR032675Leucine-rich repeat domain, L domain-likeGENE3D3.80.10.10coord: 15..187
e-value: 1.8E-30
score: 104.7
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 32..53
score: 4.84
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 77..99
score: 7.389
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 100..121
score: 8.605
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 55..76
score: 6.387

Blast
BLAST of TCONS_00001627-protein vs. Swiss-Prot (Human)
Match: AN32B (Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens GN=ANP32B PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.540e-42
Identity = 91/158 (57.59%), Postives = 113/158 (71.52%), Query Frame = 0
Query:   17 MENRIELERRGQEKKEITELNLDNTRST--SIVGLTDEYSNLEYLSLINVGLTTLKGLPGLEKLKKLELSDNRISTGLDYLL-KLPGLAYLSLSGNRIKDFESLSPLAKLSNLKSLDLFNCEVTCEKDYRAKVFELIPQLKFLDGADRDDKEMEESES 171
            M+ RI LE R +    + EL LDN +S    I GLT E+ NLE+LSLINVGL ++  LP L KLKKLELS+NRI  GLD L  KLP L +L+LSGN++KD  +L PL KL  LKSLDLFNCEVT   DYR  VF+L+PQL +LDG DR+D+E  +S++
Sbjct:    3 MKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDA 160          
The following BLAST results are available for this feature:
BLAST of TCONS_00001627-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AN32B1.540e-4257.59Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
back to top