Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001626-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001626-protein
Unique NameTCONS_00001626-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length743

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001626-protein ID=TCONS_00001626-protein|Name=TCONS_00001626-protein|organism=Clytia hemisphaerica|type=polypeptide|length=743bp
MAKTTPPFPTFDFVLNDSPVCHQSLRHWGRKASEISATVNQLSSGLDEYK
ESGLKHNEAGIALGEVMETVSKLFKGDEMLEQPFTKFADALNRIECYRDM
FLKQTEMLGVEPLQTMASELKIKKKCKSKLTKASENLHISWDKFASTPHV
SHLSEANLLDRQANVMMLARQKYQLLLSQHVQNVRDTNKRSKVVLLQKVL
EHMLAQFSFFNYCSQIMKEMEPYMNTLFDSIHKQVAEAEELSNKDIVQRQ
EMESQIENMLQNDKKLFPHSDQWSGVHTGKFFNKVGGYFSAGVKEMKRTY
KDGMGSSRRDEEDFEVIEQPSDHSQQPQPPTDNVAAAEEIEDDDTNARTV
SISQSQFYLPLKDGKTPTSSMQDENSINEAPQQEPSSQNKDETDNENQKN
TKLDSTPVPPMSPVRSEAAKGGKKLLTPQKTIDETSGYKQGYLRIKQKAF
PKSKFPLHYFILDKKYGELLSQGQDQTEPTLFAKLMLSSVKPCVTLDVDR
NFCFQLITSDADYTLQALNSQDYDEWFNAIQIGIGTALNNSHDRSRSNAR
GRSVKEEHKTSNVCQNASQRIKAVEGNDYCADCGCPRPGWASVSLGVVIC
IQCSGVHRGLGVHISKIKSLSLDKWTEDLVKIMEVSGNTKVNAIYEGNLK
GHPKPSRESPEQQRLAFITAKYVEKFFYLEPQAELIEEENEESVQEETXQ
TELIVEENEESVQEETASKVEETSLENSVSPPVTNENSDDTTN
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000845XLOC_000845Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001626TCONS_00001626Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001164ArfGAP
IPR001849PH_domain
IPR011993PH_dom-like
IPR027267AH/BAR-dom
Vocabulary: Molecular Function
TermDefinition
GO:0005096GTPase activator activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005096 GTPase activator activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001164Arf GTPase activating proteinPRINTSPR00405REVINTRACTNGcoord: 596..613
score: 59.0
coord: 617..638
score: 34.95
coord: 577..596
score: 48.62
IPR001164Arf GTPase activating proteinSMARTSM00105arf_gap_3coord: 565..685
e-value: 4.7E-46
score: 169.0
IPR001164Arf GTPase activating proteinPFAMPF01412ArfGapcoord: 567..678
e-value: 6.4E-37
score: 126.0
IPR001164Arf GTPase activating proteinPROSITEPS50115ARFGAPcoord: 565..692
score: 27.057
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 437..537
e-value: 3.5E-8
score: 43.2
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 438..533
e-value: 1.2E-7
score: 32.1
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 436..535
score: 9.215
NoneNo IPR availableGENE3D1.20.1270.60coord: 9..263
e-value: 5.4E-21
score: 74.6
NoneNo IPR availablePFAMPF16746BAR_3coord: 15..241
e-value: 3.5E-22
score: 79.2
NoneNo IPR availableSUPERFAMILY57863ArfGap/RecO-like zinc fingercoord: 568..680
IPR011993PH domain-likeGENE3D2.30.29.30coord: 364..547
e-value: 2.3E-13
score: 49.6
IPR011993PH domain-likeSUPERFAMILY50729PH domain-likecoord: 437..548
IPR027267Arfaptin homology (AH) domain/BAR domainSUPERFAMILY103657BAR/IMD domain-likecoord: 438..452
coord: 11..249

Blast
BLAST of TCONS_00001626-protein vs. Swiss-Prot (Human)
Match: ACAP3 (Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.496e-40
Identity = 91/233 (39.06%), Postives = 126/233 (54.08%), Query Frame = 0
Query:  485 LMLSSVKPCVTLDVDRNFCFQLITSDADYTLQALNSQDYDEWFNAIQIGIGTALNNSHDR------------------SRSNARGRSVKEEHKTSNVCQNASQRIKAVEGNDYCADCGCPRPGWASVSLGVVICIQCSGVHRGLGVHISKIKSLSLDKWTEDLVKIMEVSGNTKVNAIYEGNLK--GHPKPSRESPEQQRLAFITAKYVE-KFFYLEPQAELIEEENEESVQE 696
            L L SVKPC   D++R FCF++++      LQA + +    W  A+Q  I +A   S D                   S ++ R R VK E        +  QR+++V GN  C DCG P P WAS++LGV++CI+CSG+HR LGVH SK++SL+LD W  +L+K+M   GN+ VN IYE   +  G  KP+  S  Q + A+I  KYVE KF    P A  +E      VQ+
Sbjct:  315 LRLCSVKPCE--DIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGE--------SVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVNQIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQK 537          
The following BLAST results are available for this feature:
BLAST of TCONS_00001626-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ACAP31.496e-4039.06Arf-GAP with coiled-coil, ANK repeat and PH domain... [more]
back to top