Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001370-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001370-protein
Unique NameTCONS_00001370-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length330

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001370-protein ID=TCONS_00001370-protein|Name=TCONS_00001370-protein|organism=Clytia hemisphaerica|type=polypeptide|length=330bp
MSNNTLICRSAKCKTLKILNISKTMSKTIFIGVAAVVIAGIFYFYNTYDL
GVNSFSSEKDKPVATLKSVQYSMMGNKSTTACKDFSVLTWNVWFGTGQKW
DAPAKRWVELLHIVVGKKPDVIGFQECTADFLKIVQGHTEFSNLYVALND
KPAHSRYFVMIYKRKELKTLKKDTITFKTQHDRRCEYLDVEKEGAKFRFG
TVHIESYVTSPNIREIQMGAIFDVLQDKKAKNKELAFLVGDFNFHETDKE
NKFIETSQFKDTWRVVHKEAPGYSFESKHNLMNQHAMLVGEGISTPTFLR
FKKTFINKKKEKQTNTSKNGVRKLDIDRSS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000731XLOC_000731Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001370TCONS_00001370Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR005135Endo/exonuclease/phosphatase
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005135Endonuclease/exonuclease/phosphataseGENE3D3.60.10.10coord: 76..319
e-value: 6.6E-25
score: 87.5
IPR005135Endonuclease/exonuclease/phosphatasePFAMPF03372Exo_endo_phoscoord: 88..263
e-value: 1.8E-9
score: 37.4
IPR005135Endonuclease/exonuclease/phosphataseSUPERFAMILY56219DNase I-likecoord: 81..278
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 310..330

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001370-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top