Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001353-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001353-protein
Unique NameTCONS_00001353-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1143

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001353-protein ID=TCONS_00001353-protein|Name=TCONS_00001353-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1143bp
EKNQKKKVKIIRKISTKMINEATQENNNKEVRKDSFTKKENHHQKEIILE
KHHLELLLIEFKNGSSSRAGSKASAKSSLSPTAKQMDCETFSQTLSEIIK
RDGLIQNDDLINSSCQMLFKKIDWRKRGIISWDDVCSYFILESKDSEEVI
DKQSAFVSQPHIVKFSTLKDNISKLVPESNPSRFILVTKTGHICMFTSDL
CLSKKLHMEDPLETSLDEVPKKRRTKLWVTDCVCIKELNKLVICTANRDL
QIFDLSTPHCSQQFQLYALPNAVLCMVYHYIPSNPYDQLWLFFGTDNGDV
HWLKFHMANKSLFQMPFKKTDSCWKILFSDLANQSKYVSHQLFSHMHSDW
VRRLQYVPQGDLLFSCSSNGHDSLVYRSLDETKRKVYVFKVTKGIECFAY
NKELALIATGGVDHVLRLWDPYVTSKPMAILKTHQTSIIDVMIYEPLQQV
VSYSKDGVIMTWDIKDQSPLQHLSIKFPFTGTVLEHGGFPLCLTSHGSLF
VAAEDCIAELKLTTAGAHRQNASHKGCVVAVYHIPHKNQIISASEFGDIC
TWSLDSGRKSSTIQTNQKSKEVLAFTIDKNAEFAVTGHIDGSGQLWNLIS
GKQEKTLAAYSDEEITNCIALPNASIIFMLGWSKKILMYKNTNQYKKLTT
LRPDTGWLSISSHKDDIISAAFWEPHFLATGTFDGDIFIWHIEHERLWRK
IQIGRGQPLFQSLVNQYIMPPRTARSGRRREKQHQVLRVSDEERPPTNQQ
QKEHGEYTMPVDLLLYLGHRDHETYASLIATEGNRVNWWSTTAIGTPVAS
FTISEDTEKVITAITSDLDNRYVIVGTNQGEVSIWNIVTYGVYRRFADVV
REGTPSTPKSTPLTETFRERPPCVHTWSCRSMDMIVSLCCFKRDKEMVAV
GLETGCISLFALSGDYIGMFSQIEPWNLTESSERIQTKSPNIEEPQRELC
TEKDEEEEEKVDLNIKNDVHNNEAENLVGEPADVQQSQSLPELGVSNRPP
IPASTTGSVGGNTKDNTISNDVQKMKKTEYYQTISSINDDIVQQKAAWSL
LGEKYNSNFKRRMQERLSRRRHFSDVTVASGDKPLLQHSGGLGNLCSPFQ
ALSTKDCEDFVLPKGLPITSRMTAHSIDPYNGNSLEQMSSFGH
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000728XLOC_000728Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001353TCONS_00001353Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 19..39
NoneNo IPR availableCOILSCoilCoilcoord: 946..973
NoneNo IPR availableGENE3D2.80.10.50coord: 506..561
e-value: 1.2E-4
score: 21.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 724..754
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 992..1018
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 932..958
NoneNo IPR availableSUPERFAMILY101908Putative isomerase YbhEcoord: 347..370
coord: 222..317
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 653..691
e-value: 0.61
score: 18.4
coord: 338..377
e-value: 6.5
score: 11.9
coord: 870..911
e-value: 320.0
score: 1.2
coord: 215..254
e-value: 330.0
score: 1.1
coord: 556..597
e-value: 10.0
score: 10.6
coord: 600..640
e-value: 220.0
score: 2.2
coord: 424..463
e-value: 0.99
score: 17.0
coord: 794..836
e-value: 4.4
score: 12.9
coord: 514..553
e-value: 130.0
score: 3.7
coord: 382..420
e-value: 0.0016
score: 27.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 386..420
e-value: 0.0053
score: 17.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 660..700
score: 8.871
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 431..472
score: 9.773
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 395..420
score: 8.67
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 330..505
e-value: 1.2E-18
score: 66.6
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 562..993
e-value: 3.9E-25
score: 87.9
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 9..327
e-value: 2.4E-9
score: 36.0
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 344..700
score: 16.744
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 659..712
coord: 760..841
coord: 873..913
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 337..473
coord: 522..692

Blast
BLAST of TCONS_00001353-protein vs. Swiss-Prot (Human)
Match: WDR49 (WD repeat-containing protein 49 OS=Homo sapiens GN=WDR49 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.018e-42
Identity = 129/479 (26.93%), Postives = 219/479 (45.72%), Query Frame = 0
Query:  374 LVYRSLDETKRKVYVFKVTKGIECFAYNKELALIATGGVDHVLRLWDPYVTSKPMAILKTHQTSIIDVMIYEPLQQVVSYSKDGVIMTWDIKDQSPLQHLSIKFPFTGTVLEHGGFPLCL----TSHGSLFVAAEDCIAELKLTTAGAHRQNASHKGCVVAVYHIPHKNQIISASEFGDICTWSLDSGRKSSTIQTNQKSKEVLAFTIDKNAEFAVTGHIDGSGQLWNLISGKQEKTLAAYSDEEITNCIALPNASIIFMLGWSKKILMYK--NTNQYKKLTTLRPDTGWLSISSHKDDIISAAFWEPHFLATGTFDGDIFIWHIEHERLWRKIQIGRGQPLFQSLVNQYI-MPPRTARSGRRREKQHQVLRVSDEERPPTNQQQKE-HGEYTMPVDLLLYLGHRDHETY---ASLIATEGN-RVNWWSTTAIGTPVASFTISEDTEKVITAITSDLDNRYVIVGTNQGEVSIWNIVTY 840
            + +R   + +  +  F + +GI  F Y+  L LIAT G+++ + LW+PYV SKP+ +L  H  S+I V  +   +Q+ S+SKD V+  WDI+ Q  +Q ++  FP +           CL     +HG LF++  + +A L + +  + R   SH+  V  V +     Q+IS+     +  W +D+G+K         + E+    +D N    +TG  DG+ ++W+  +G    TL    D  +     L     I + GW + I +++  N NQ+     ++P+  W     H DDI+ AAF  P  L TG++DG+I +W+   E     +      P +Q L+   +   P+   S  R +  H +      +   T  +  E   E    V  L +L  R +      A+L++  G+  V +W        +A F        +I  +++D  NRY+  G   G + IWNI  Y
Sbjct:    1 MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQDF-------RCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVK-SHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTGCHGNAEISTMALDANETRLLTGSTDGTVKIWDF-NGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQF----FIQPEE-WKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVL-----HPDYQRLLKSKLDTKPQKLLSAGRSQPSHPM-----ADHSTTGVRNFEIDTEGKNAVMRLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYK-KQLLAEFLAHSGVGSII--MSTDKMNRYLTTGDLDGWLKIWNIEEY 452          
The following BLAST results are available for this feature:
BLAST of TCONS_00001353-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
WDR493.018e-4226.93WD repeat-containing protein 49 OS=Homo sapiens GN... [more]
back to top