Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001320-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001320-protein
Unique NameTCONS_00001320-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length708

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001320-protein ID=TCONS_00001320-protein|Name=TCONS_00001320-protein|organism=Clytia hemisphaerica|type=polypeptide|length=708bp
FDDEDYENADAGFCEGSPPLQPPLQPPPRTYSQNVNTFNNSNDSIDESKS
YNYLSQDDQDDIYDTPETEEIARPPPLQQKPQRPGGYARQPQHQTPIPQH
QSPIPQHQSPIPQHQSPAAHQDNFNMSNKRTQNIDKHRQQSFANSRAMFE
QRSTSPPQPAINRSAKPPVQQRRSDSNNNPPFAPKPNISKRPTIPTPAAQ
QRVVPPQPIQLQEPQHYEMDNQSEDSGCHEDFYIEPHQAKNAVIPHEEET
YEVTDGPTSPVEIISSKPKGMPGQQFITQLNRMTLERSAPSLPASQSKPM
AGRPLVPTPDQEETYEIAPENPRSPPLPGNHPSAAKSPGIPSRPFVQSRP
PMPVPSPPPQEEETYEVTPDQAPALPPSHPSSRKSSSTSSIGESPRTSIK
DRLPNPRDNIQEDYEMITHSQRPPPQLPISSRPSPPQQRRPPPSLEPKGQ
EPVLPPRNEKPQRLLPSPSQEINIPPRTPKMSQPQNSMPPKLMGSLPTFS
LSNSWLEDVKCGQRKTSLDMGAISPKLFRRINDRRSSLSADEIQVNHSTA
CVLGPSHPAFQQATMSLDRSKDTCPQPTIERIPSYKKQTQSANAPTPINR
QTPAPAHPLSGFTWFQPELDRRACEIKLNQNRRDGDFVIRNSSKAGVPFS
ISIFHDNVVRNLQLLQKDGKMYLGSSTEGFEGVPELVSYHQNNEIILNTG
GKVKLLRI
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000718XLOC_000718Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001320TCONS_00001320Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000980SH2
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainSMARTSM00252SH2_5coord: 612..696
e-value: 7.9E-17
score: 71.9
IPR000980SH2 domainPFAMPF00017SH2coord: 614..690
e-value: 3.1E-9
score: 36.7
IPR000980SH2 domainGENE3D3.30.505.10coord: 598..704
e-value: 3.4E-16
score: 58.6
IPR000980SH2 domainPROSITEPS50001SH2coord: 614..708
score: 13.771
IPR000980SH2 domainSUPERFAMILY55550SH2 domaincoord: 592..704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..492
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 585..605

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001320-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top