Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001311-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001311-protein
Unique NameTCONS_00001311-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length669

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001311-protein ID=TCONS_00001311-protein|Name=TCONS_00001311-protein|organism=Clytia hemisphaerica|type=polypeptide|length=669bp
MNHDRARVSLDAYDEQPRQEYVKCVVVGDTAVGKSRLICSYVFGQPGLSL
TTLYQRPHIPTVFAIDQYVIDLAVRKRASTVVNGAPVQLRIWDTFGDHEK
DRRFSFQNAHVVVVCFSIGSWSSLRNVNAKWYPEIKKYCPRAPIILVGTQ
LDRRHSDPTLFNHASQVTTLTDVLNSSFKGLWCKSNNNEFVRSIAPEIGR
QTSREINASSYLETSIVTKHGVDQVFESAIRAALVYRRQTRAMLFSSYLK
CVEEPGIQKPYLPEKLPEPEIHAFSPYKFYEFKTLLKEQGLSDVTFLVGH
EMIPAHSVPLIASSNIMKLLLSIPELCNLLGYKEVPSLSCGNIKTMEGYV
NGFSDFNLPQGYHSVEVTPNQFGVHNVCVQVLNVDPISFGLVLEYLYTGS
ISNIPDPIQLLDVASYLQEELLLCYLSNLINKEDFLNASIKSQFQGVQQK
NCESLLEQPFYADVIFLVDGIMIPVHKQVLVSQCPMMDAMFKEGVFKESM
LEQVDFRDTNLESFRSVLEYLYTGECKEMSDLHGTLQLANFLCLRHLVMI
CEDRIAKYITQMRQEENNDVYEYVIGSYILGEYHNAPQLSAWCLHFMSTN
YNDLCRHQKKEMKNSLDEETLKHLEEHRWPPVWYLKEQDYYEKTVQRMLT
EQNEKRERKKRKRICSGCF
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000715XLOC_000715Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001311TCONS_00001311Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR003578Small_GTPase_Rho
IPR011333SKP1/BTB/POZ
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007264 small GTPase mediated signal transduction
cellular_component GO:0005622 intracellular
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 22..43
score: 41.55
coord: 140..153
score: 36.9
coord: 80..102
score: 31.68
coord: 211..233
score: 31.57
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 18..236
e-value: 8.1E-4
score: -51.1
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 22..236
e-value: 9.5E-7
score: -25.4
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 24..236
e-value: 6.0E-33
score: 125.5
NoneNo IPR availableGENE3D3.40.50.300coord: 102..234
e-value: 2.3E-18
score: 65.5
NoneNo IPR availableGENE3D3.30.70.1390coord: 20..101
e-value: 4.3E-7
score: 29.3
NoneNo IPR availableGENE3D3.30.710.10coord: 271..435
e-value: 6.1E-12
score: 45.0
NoneNo IPR availableGENE3D3.30.710.10coord: 447..609
e-value: 3.5E-28
score: 97.9
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 462..559
e-value: 6.2E-17
score: 72.3
coord: 292..434
e-value: 1.7E-6
score: 37.5
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 453..555
e-value: 7.1E-19
score: 68.0
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 292..405
score: 8.607
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 462..525
score: 14.687
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 21..159
e-value: 1.2E-12
score: 45.9
IPR001806Small GTPase superfamilyPFAMPF00071Rascoord: 23..233
e-value: 4.9E-25
score: 87.9
IPR003578Small GTPase superfamily, Rho typePROSITEPS51420RHOcoord: 15..233
score: 17.694
IPR011333SKP1/BTB/POZ domainSUPERFAMILY54695POZ domaincoord: 450..558
IPR011333SKP1/BTB/POZ domainSUPERFAMILY54695POZ domaincoord: 372..429
coord: 271..321
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 20..157
coord: 191..239

Blast
BLAST of TCONS_00001311-protein vs. Swiss-Prot (Human)
Match: RHBT2 (Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=1 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 7.585e-56
Identity = 111/250 (44.40%), Postives = 156/250 (62.40%), Query Frame = 0
Query:   15 EQPRQEYVKCVVVGDTAVGKSRLICSYVFGQPGLSLTTLYQ--RPHIPTVFAIDQYVIDLAVRKRASTVVNGAPVQLRIWDTFGDHEKDRRFSFQNAHVVVVCFSIGSWSSLRNVNAKWYPEIKKYCPRAPIILVGTQLDRRHSDPTLFNHASQVTTLTDVLNSSFKGLWCKSNNNEFVRSIAPEIGRQTSREINASSYLETSIVTKHGVDQVFESAIRAALVYRRQTRAMLFSSYLKCVEEPGIQKPYL 262
            E+P  E +KCVVVGD AVGK+RLIC+        +  T YQ    H+PTV+AIDQY +   V +R+  VV+   V LR+WDTFGDH KDRRF++  + VVV+CFSI + +SL +V   WYPEIK +CPRAP+ILVG QLD R++D              + +N + + L      NE    + PE GR+ ++E+    Y ETS+V + G+  VF++AIRAAL+ RR  +   + S+L+ V+ P +Q P+L
Sbjct:    8 ERPNVETIKCVVVGDNAVGKTRLICARACN----ATLTQYQLLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYAD-------------LEAVNRARRPLARPIKPNEI---LPPEKGREVAKELGI-PYYETSVVAQFGIKDVFDNAIRAALISRRHLQ--FWKSHLRNVQRPLLQAPFL 234          

HSP 2 Score: 171.014 bits (432), Expect = 5.735e-45
Identity = 104/287 (36.24%), Postives = 158/287 (55.05%), Query Frame = 0
Query:  383 NVDPISFGLVLEYLYTGSIS-NIPDPIQLLDVASYLQEELLLCYLSNLINKEDFLNASIKSQFQGVQQKNCESLLEQPFYADVIFLVDGIMIPVHKQVLVSQCPMMDAMFKEGVFKESMLEQVDFRDTNLESFRSVLEYLYTGECKEMSDLHGT--LQLANFLCLRHLVMICEDRIAKYI---TQMRQEENNDVYEYVIGSYILGEYHNAPQLSAWCLHFMSTNYNDLCRHQKKEMKNSLDEETLKHLEEHRWPPVWYLKEQDYYEKTVQRMLTEQNEKRERKKRKR 663
            ++ P  F  VL+YLYTG +  N  D + +  +A  L+   L   ++N++N E F+N  I   F   +    +  L +  ++DV F++D   I  HK +L+S C  M AMF  G F ES   +V F  T+    R+VLEYLYTG      DL     + LAN LCL HLV + E      +   TQM  + + DV  ++     L ++H A QL+ WCLH + TNYN++CR   ++MK ++  E  ++ E+HRWPPVWYLKE+D+Y++  +    E     +R+ ++R
Sbjct:  420 SIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFG-GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFL----ELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMK-AMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR 700          
The following BLAST results are available for this feature:
BLAST of TCONS_00001311-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RHBT27.585e-5644.40Rho-related BTB domain-containing protein 2 OS=Hom... [more]
back to top