Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001310-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001310-protein
Unique NameTCONS_00001310-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length199

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001310-protein ID=TCONS_00001310-protein|Name=TCONS_00001310-protein|organism=Clytia hemisphaerica|type=polypeptide|length=199bp
MTSLKIVCIMSSVRDGRMAERMRILIQKQFDEILTPKGHSIHFIDPEEYD
FPVLKTPLHFYPDQSEAPEKLRKLNDIVIAADAYIILTAEYNRSMPPALT
NLMNHLPPPSFEFKPSGMVGYSQGNLGGAMAMAAARPFLSEMGCLPVKHF
VVIPYVQNEVKEDGSTDNTHIHSSLKKLFTQVEWWAQAAKTQRTSGTPN
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000714XLOC_000714Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001310TCONS_00001310Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR029039Flavoprotein-like_dom
IPR005025FMN_Rdtase-like
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029039Flavoprotein-like domainGENE3D3.40.50.360coord: 2..196
e-value: 4.1E-25
score: 88.1
IPR029039Flavoprotein-like domainSUPERFAMILY52218Flavoproteinscoord: 5..187
IPR005025NADPH-dependent FMN reductase-likePFAMPF03358FMN_redcoord: 5..153
e-value: 1.7E-21
score: 76.4

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001310-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top