Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001301-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001301-protein
Unique NameTCONS_00001301-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length436

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001301-protein ID=TCONS_00001301-protein|Name=TCONS_00001301-protein|organism=Clytia hemisphaerica|type=polypeptide|length=436bp
MFCVKLYMVLLLISSFLLIEVWSKDCRLSEKNITDEELSTALEGCENGTE
LINLKRNSLHLFDPVLFRRFHKLKFLFLDENNIKNFPKNMSKNLFSLKHL
TLTKNNIEHIPQNLDLPNLTDLDLSRNNITYLAPYSFARMHGLKTLYLSR
NKLHKVTIDAFTGLTSLQRLFLDHNEIDVLYAGVLNGLVSLQKFNAAHNQ
LQRVRKGVMNNFRYLTDIILKDNFISTLDDRSFQGLKIHVLDMQNNRLKA
IRNNVFSSLVIFGKINMKGNPLVCDCWLMHRNIIDLRMKGELQGDCATPP
RLKGRNIRQLSKIHLPLCKTYDSCEDHLCQNEASCLQVNETVYKCECLKG
FYGDQCEKARQDTEYTLLIILSVCLGVVITIGVIVAFIIRARKNRNVHGR
CVSKETCCCFMILGVFFFLFALFVGLRVACKFHEYC
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000705XLOC_000705Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001301TCONS_00001301Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675L_dom-like
IPR013032EGF-like_CS
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 323..357
e-value: 0.0016
score: 27.7
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 320..357
score: 17.823
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 164..187
e-value: 1.6
score: 17.8
coord: 212..235
e-value: 170.0
score: 3.2
coord: 94..115
e-value: 23.0
score: 10.2
coord: 70..93
e-value: 20.0
score: 10.8
coord: 188..211
e-value: 46.0
score: 7.9
coord: 116..139
e-value: 8.3E-4
score: 28.6
coord: 237..258
e-value: 130.0
score: 4.2
coord: 140..163
e-value: 0.55
score: 19.3
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 214..272
e-value: 1.7E-6
score: 27.6
coord: 142..201
e-value: 8.0E-14
score: 51.0
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 96..117
score: 8.066
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 118..139
score: 8.12
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 142..163
score: 6.226
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 214..235
score: 5.101
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 166..189
score: 5.302
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 237..258
score: 5.802
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 72..93
score: 6.541
IPR032675Leucine-rich repeat domain, L domain-likeGENE3D3.80.10.10coord: 125..169
e-value: 7.3E-14
score: 51.0
IPR032675Leucine-rich repeat domain, L domain-likeGENE3D3.80.10.10coord: 22..124
e-value: 1.0E-14
score: 53.4
IPR032675Leucine-rich repeat domain, L domain-likeGENE3D3.80.10.10coord: 170..320
e-value: 4.8E-20
score: 71.0
IPR032675Leucine-rich repeat domain, L domain-likeSUPERFAMILY52058L domain-likecoord: 30..279
NoneNo IPR availableGENE3D2.10.25.10coord: 321..360
e-value: 6.1E-9
score: 35.2
NoneNo IPR availableCDDcd00054EGF_CAcoord: 322..357
e-value: 0.00207066
score: 34.9198
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 321..361
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 345..356
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 345..356

Blast
BLAST of TCONS_00001301-protein vs. Swiss-Prot (Human)
Match: CHADL (Chondroadherin-like protein OS=Homo sapiens GN=CHADL PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 4.679e-24
Identity = 80/307 (26.06%), Postives = 137/307 (44.63%), Query Frame = 0
Query:   38 LSTALEGCENGTELINLKRN-----------------SLHL-------FDPVLFRRFHKLKFLFLDENNIKNFPKNMSKNLFSLKHLTLTKNNIEHIPQNL--DLPNLTDLDLSRNNITYLAPYSFARMHGLKTLYLSRNKLHKVTIDAFTGLTSLQRLFLDHNEIDVLYAGVLNGLVSLQKFNAAHNQLQRVRKGVMNNF-RYLTDIILKDNFISTLDDRSFQGL--KIHVLDMQNNRLKAIRNNVFSSLVIFGKINMKGNPLVCDCWL--MHRNIIDLRMKGELQGDCATPPRLKGRNIRQLSKI 313
            L     G  + T+L++L+RN                 SLHL        +        +L +L+L +N +        +    L +L L +N    +P      LP+L  L L  N +  LAP    R   L+ +YLS N++ +V++ A      L++L LD N++  +  G L GL +L +   + N L+ +R G      R L  + L  + +  +   +F GL   +  L +Q N+L+A+      SL     I++  NP  CDC L  +HR +  L ++  +   CATPP  +G+ ++  + +
Sbjct:  416 LQAVPRGFPSDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYLSDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGDLGRTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQLSGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLHLQKNQLRAL--PALPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLR--VGATCATPPNARGQRVKAAAAV 718          

HSP 2 Score: 81.6481 bits (200), Expect = 1.918e-16
Identity = 78/296 (26.35%), Postives = 131/296 (44.26%), Query Frame = 0
Query:   49 TELINLKRNSLHLFDPVLFRRFHKLKFLFLDENNIKNFPKNMSKNLFSLKHLTLTKNNIEHIPQN-LD-LPNLTDLDLSRNNITYLAPYSFARMHGLKTLYLSRNKLHKVTIDAFTGLTSLQRLFLDHNEIDVLYAGVLNGLVSLQKFNAAHNQLQRVRKGVMNNFRYLTDIILKDNFIS----------------TLDDRSFQGL---------KIHVLDMQNNRLKAIRNNVFSSLVIFGKINMKGNPLVCDCWLMHRNIIDLRMKGELQGD--CATPPRLKGRNIRQLSKIHL 315
            T+ ++L+ N L +     F+    L  L L    ++   +   + L  L  L L  N++  +PQ  LD L +L  L+L  N +  L P +F  +  L TL L+ N L  +   AF GL  ++ L L HN + VL    L GL +L++ +  HN+LQ +   V++  R L  + L  N ++                 LD  + Q L         ++H LD++ N+L  +            ++ ++GNPL C C    R +++   +  ++ D  C  P RL+G  +  L    L
Sbjct:   64 TQRLDLQGNLLKVIPAAAFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASNHLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTL--PPLQGPGQLRRLRLQGNPLWCGC--QARPLLEWLARARVRSDGACQGPRRLRGEALDALRPWDL 355          
The following BLAST results are available for this feature:
BLAST of TCONS_00001301-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CHADL4.679e-2426.06Chondroadherin-like protein OS=Homo sapiens GN=CHA... [more]
back to top