Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001269-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001269-protein
Unique NameTCONS_00001269-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length216

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001269-protein ID=TCONS_00001269-protein|Name=TCONS_00001269-protein|organism=Clytia hemisphaerica|type=polypeptide|length=216bp
MRSIVACLALLNVIVNAQYSPSNYNGTTPDLESIMKGRCSQYKVFNRDPE
LQVKVDCNELWNTFTKAFINKDPCKVNFTGAYKKTFELIDNKQFYTNKTM
FWTGTRDVVHDFTHVNDDYRTLEETFAGYFANDLNWCGCDNCAGGIDYDF
CNETCNKLIPFHGYTSEYWAEASRIVCSNALKIKCTTSPLKVSKPFFNKP
YSKQIRTLLKILFTIY
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000673XLOC_000673Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001269TCONS_00001269Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003193ADP-ribosyl_cyclase
Vocabulary: Molecular Function
TermDefinition
GO:0003953NAD+ nucleosidase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003953 NAD+ nucleosidase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003193ADP-ribosyl cyclase (CD38/157)PFAMPF02267Rib_hydrolaysecoord: 28..175
e-value: 1.1E-31
score: 110.1
NoneNo IPR availableGENE3D1.20.82.10coord: 109..180
e-value: 3.0E-8
score: 33.5
coord: 27..108
e-value: 3.3E-18
score: 65.6
NoneNo IPR availableSUPERFAMILY52309N-(deoxy)ribosyltransferase-likecoord: 21..180

Blast
BLAST of TCONS_00001269-protein vs. Swiss-Prot (Human)
Match: CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens GN=CD38 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 9.762e-19
Identity = 52/153 (33.99%), Postives = 75/153 (49.02%), Query Frame = 0
Query:   26 GTTPDLESIMKGRCSQYKVFNRDPELQVKVDCNELWNTFTKAFINKDPCKVNFTGAYKKTFELIDNKQFYTNKTMFWTGTRDVVHDFTHVNDDYRTLEETFAGYFANDLNWCGCDNCAGGIDYDFCNE-----TCNKLIPFHGYTSEYWAEAS 173
            GTT      +  RC +Y   +  PE++  VDC  +W+ F  AFI+K PC  N T    +    +  +    NK + W+  +D+ H FT V  D  TLE+T  GY A+DL WCG  N    I+Y  C +     + N +  F    S  +AEA+
Sbjct:   54 GTTKRFPETVLARCVKYTEIH--PEMR-HVDCQSVWDAFKGAFISKHPC--NITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFN-TSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA 200          
The following BLAST results are available for this feature:
BLAST of TCONS_00001269-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CD389.762e-1933.99ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 ... [more]
back to top