Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001258-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001258-protein
Unique NameTCONS_00001258-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length351

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001258-protein ID=TCONS_00001258-protein|Name=TCONS_00001258-protein|organism=Clytia hemisphaerica|type=polypeptide|length=351bp
MCRHLVVYILLVLASLYRSTHSAGTTPGIKEVFVGRCWQYQSISEHNKLP
ELKVNINCTKLWLAFYDSFAFKDPCTVGVDDYKTFFDMLHTSRKIKNALF
WSGLHDLVTDFTFINDDYIVLEDTLTGYLLNNLNWCGGTDADGLNSTSCS
KTCNVMTPAWTLASSEFAKRSTETAKVLLNATRANNKDAYADGSFFRTVE
MPELQVDKLVVYLASSIGKEVRERCADSISMENIRADAEAKNIQVECIDQ
PSLVLNVYCLKYPKAKECVNKDNFRSDSNADKEEARLWKTVCLILVAVVA
VLIVYITISLVHRAVCYKPGDYKYSHSWSFSKKPMLQDDEVENNNDIERV
V
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000669XLOC_000669Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001258TCONS_00001258Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003193ADP-ribosyl_cyclase
Vocabulary: Molecular Function
TermDefinition
GO:0003953NAD+ nucleosidase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003953 NAD+ nucleosidase activity
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D1.20.82.10coord: 18..159
e-value: 1.8E-31
score: 108.4
NoneNo IPR availableGENE3D3.40.50.720coord: 160..271
e-value: 6.0E-21
score: 74.3
NoneNo IPR availableSUPERFAMILY52309N-(deoxy)ribosyltransferase-likecoord: 20..263
IPR003193ADP-ribosyl cyclase (CD38/157)PFAMPF02267Rib_hydrolaysecoord: 26..268
e-value: 3.7E-53
score: 180.3

Blast
BLAST of TCONS_00001258-protein vs. Swiss-Prot (Human)
Match: CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens GN=CD38 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 4.491e-29
Identity = 79/260 (30.38%), Postives = 125/260 (48.08%), Query Frame = 0
Query:   22 SAGTTPGIKEVFVGRCWQYQSISEHNKLPELKVNINCTKLWLAFYDSFAFKDPCTVGVDDYKTFFDMLHTSRKIKNALFWSGLHDLVTDFTFINDDYIVLEDTLTGYLLNNLNWCGGTDADGLNSTSCS---KTC--NVMTPAWTLASSEFAKRSTETAKVLLNATRANNKDAYADGSFFRTVEMPELQVDKLVVYLASSI--GKE-VRERCADSISMENIRADAEAKNIQVEC--IDQPSLVLNVYCLKYPKAKECVNK 271
              GTT    E  + RC +Y  I      PE++ +++C  +W AF  +F  K PC +  +DY+    +   +      L WS + DL   FT +  D   LEDTL GYL ++L WCG  +   +N  SC    K C  N ++  W   S  FA+ + +   V+LN +R+     +   S F +VE+  LQ +K+    A  I  G+E  R+ C D  +++ + +    +NIQ  C  I +P   L   C+K P+   C ++
Sbjct:   52 GPGTTKRFPETVLARCVKYTEIH-----PEMR-HVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSK---IFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDP-TIKELESIISKRNIQFSCKNIYRPDKFLQ--CVKNPEDSSCTSE 299          
The following BLAST results are available for this feature:
BLAST of TCONS_00001258-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CD384.491e-2930.38ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 ... [more]
back to top