Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00001104-protein ID=TCONS_00001104-protein|Name=TCONS_00001104-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00001104-protein vs. Swiss-Prot (Human)
Match: TUSC2 (Tumor suppressor candidate 2 OS=Homo sapiens GN=TUSC2 PE=1 SV=3) HSP 1 Score: 68.9366 bits (167), Expect = 1.036e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 33 PFVDSKPSRMYYDEDGDLAEEFYEE--VTPQ-QGTPWMRRVTKNLTKQGVVPLEIQRLHPDFPLVMCDV 98 PFV ++ M+YDEDGDLA EFYEE VT Q +RRV KNL QG+V L+ R+H DFP+++ +V Sbjct: 42 PFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV 110 The following BLAST results are available for this feature:
BLAST of TCONS_00001104-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|