Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000270-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000270-protein
Unique NameTCONS_00000270-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length855

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000270-protein ID=TCONS_00000270-protein|Name=TCONS_00000270-protein|organism=Clytia hemisphaerica|type=polypeptide|length=855bp
FSGFILAQQKLYIQTMKTLRSRKKTPIPGRRHKPKDVYHPTAQKPPLYHL
KKKYSNLERSGTYIKMSDDEKVNKYIRNKGILTRRNINDRTYDRTYDRFT
DPFYAKAPRRNLSRLSNISYERGYPDAATYNGRYASHANPYARKEQFADK
KVQFFRSHSSTQELTLVISATRHGTLADVRDDVCETFFRRGIFLGEERYI
HTAHGNILKNIYEFEHGGKYFFGPAHIFDMNEYDQFSKTNSPAQSASGSN
KGSASKGVLSEDSLKSNGGRSSVSGVNESSKSQNGGPSSKSGGASFQNGG
PSSMNGGSRLKNGGASSLNKSQNGSAPSQGESKQSYAQSGSGRTNKISSR
LSNLTINDVRSNRSNSQTSGSGGPTGVSRVSQRRRCNIKITVDHNPETLC
SFTVDESRHRNIAQLMSDLSFQLHLRTNQITKIFTMSGRLINRVDELFLG
DHFNAMTSSFTGNGYGHIPYAHVRDPINRYTDYHNPYQVTVEAAGTSHVF
ELPSQEYDQIYRRGAELYNDLQLDWVYGYNGRNCRNNIVLLPSEELLYFV
AKVVVIFNDQQQTQRFYAEHTDEIRSIAQHPSNLWQIATGQVSGGDSGDM
AHVRIWDSKILHTLNVLEFDSMNLSVECLDFCSSNNGERLATVANGNGEW
YLTVWDWEEGIKLSHSEPYEDHYAELDIQFDPFDSTSVVTCGKEHVFFWD
VSQPDAVYRVGFFEDYSTPEYVTCCSFNHDGRLITGDSNGYIHVWDTHLK
RTLSTVPTNHTGSIITLRVLSDFHVVTGGGADRKLTLVSLIDSVPTKAEF
ELPEHVGGVVSIVPLFGGFSGGDKDFDFLRLVVGTSCNSILAGSMTEAFE
CIVKG
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000145XLOC_000145Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000270TCONS_00000270Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR003533Doublecortin_dom
IPR005108HELP
IPR015943WD40/YVTN_repeat-like_dom
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0035556intracellular signal transduction
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035556 intracellular signal transduction
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 706..746
e-value: 0.012
score: 24.8
coord: 662..700
e-value: 310.0
score: 1.3
coord: 560..607
e-value: 4.5
score: 12.9
coord: 612..656
e-value: 140.0
score: 3.4
coord: 750..789
e-value: 42.0
score: 6.7
IPR003533Doublecortin domainGENE3D3.10.20.230coord: 337..472
e-value: 0.0017
score: 17.8
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 404..453
e-value: 2.3E-5
score: 24.3
IPR003533Doublecortin domainSUPERFAMILY89837Doublecortin (DC)coord: 390..454
IPR005108HELPPFAMPF03451HELPcoord: 512..558
e-value: 2.0E-15
score: 56.3
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 669..841
e-value: 2.5E-16
score: 59.1
IPR015943WD40/YVTN repeat-like-containing domainGENE3D2.130.10.10coord: 489..668
e-value: 7.0E-8
score: 30.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 237..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..43
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 733..747
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 715..798
score: 8.861
IPR017986WD40-repeat-containing domainSUPERFAMILY50978WD40 repeat-likecoord: 521..812

Blast
BLAST of TCONS_00000270-protein vs. Swiss-Prot (Human)
Match: EMAL1 (Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens GN=EML1 PE=1 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 1.124e-62
Identity = 129/338 (38.17%), Postives = 192/338 (56.80%), Query Frame = 0
Query:  521 LQLDWVYGYNGRNCRNNIVLLPSEELLYFVAKVVVIFNDQQQTQRFYAEHTDEIRSIAQHPSNLWQIATGQVSG--GDSGDMA-HVRIWDSKILHTLNVLEFDSMNLSVECLDFCSSNNGERLATVANGNGEWYLTVWDWEEGIKLSHSEPYEDHYAELDIQFDPFDSTSVVTCGKEHVFFWDVSQPDAVYRVGFFEDYSTPEYVTCCSFNHDGRLITGDSNGYIHVWDTHLKRTLSTVPTNHTGSIITLRVLSDFHVVTGGGADRKLTLVSLIDSVPTKAEFELPEHVGGVVSIVPLFGGFSGGDKDFDFLRLVVGTSCNSILAGSMTEAFECIVKG 855
            L+L+WVYGY GR+CRNN+ LLP+ E +YF+A VVV++N ++Q QR YA H D+++ +A HP  +  IATGQV+G   D   +  HVRIWDS  L+TL+V+     + +V C+ F  SN G  L  V + N    L+VWDW++  KL+  +   +     D  F P D+  +VTCGK H++FW +       + G FE    P++V C +F+ +G  ITGDS+G I VW     R    V   H G I  L +L D  +V+GGG DRK  L+S   +     + E+PE  G + ++       + G  D     +++GT+ N +L G+++  F  I +G
Sbjct:  221 LKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRI-TIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDH-VLSVWDWQKEEKLADVKCSNEAVFAAD--FHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRK--LISWSGNYQKLRKTEIPEQFGPIRTV-------AEGKGDV----ILIGTTRNFVLQGTLSGDFTPITQG 541          
The following BLAST results are available for this feature:
BLAST of TCONS_00000270-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
EMAL11.124e-6238.17Echinoderm microtubule-associated protein-like 1 O... [more]
back to top