Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000180-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00000180-protein
Unique NameTCONS_00000180-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length935

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000180-protein ID=TCONS_00000180-protein|Name=TCONS_00000180-protein|organism=Clytia hemisphaerica|type=polypeptide|length=935bp
MGHIHTYRSIDATLSLSYRYRKTSWLGLRFLRIIYAQKAPLMLHYLNVLT
AGPNLTMGYVVGKVFALILASAGIIHLLENTGDPWVDGDSNRQKLTYFEC
VYFMIVTLSTVGYGDFSCNTYLGRVFCMLIIIFGLGLFASYIPMIFDFIS
SHTKYDRKFKTTPGKKHVVVTGHITDETVSAFVQDFLHPDRAFNNTSVVF
LAPNHPTVVIQSILQRYFSKVSYFVGTIYKHHDCERVQMQEADAVIILCD
KKCTNPDAEDAGNITRVILVKKFYRHVRCIVQLMRKASKAHIYNCPQWKE
SNGDAIVCIDELKLGIMAQSCNAPGFSTLLANLFVMRENENKHYQDNWRE
TYLSGVSVEMYSTLLSDYFIGMSFPKAVEICFTKLNLLLIAVEVHHKDKG
EIFAINPSSSLRLTKGSRAFFISQDADDVSKARFYCDRCHTNHTSSKRML
PKCKCMSGSSSNVSLEGSFENLKKDHSTTNGKNHVTVSLDNPGYNNKVTM
NGKTLNKFNSSSMKKKTLPPLDYKNSKREMFDETGTFFWCPEKLLEDAIM
SLEVAEQEMFDGHVVILVISDVRAPSLGLQQLIQPLRASNQPYEDLKKII
ILGDDKFLAREWSTINTFPDVHIVTGSPYSRVDLRAVNVHTADMCILLSP
FKNVVFEQEEHEAMSDKEVIMVALNLRAMTFDNISKSTLTSPVPYDELPS
YKSNFNVQNSFDMLYSENALMAIGTCNLDTNGDTITGENIRMITELVYDS
NTLYLDDERQSQCSSEGIWMTQSYACGSVFTVSVLDFLASATYFNQDTLT
LVLNLVTGSVNPELDKILAEGKKPDGVLENESIAATRNRCRVDQLSLDDP
HFAAMGRINEYGDLFVKSIQEHNMLCLGLYRLHTNSSKTMSLNTRYVITF
PSRDMRLEPTDRVFVLMQFKEDKGDFYTSSEDSQM
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000106XLOC_000106Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000180TCONS_00000180Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003929K_chnl_BK_asu
IPR013099K_chnl_dom
Vocabulary: Biological Process
TermDefinition
GO:0006813potassium ion transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006813 potassium ion transport
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01449BKCHANNELAcoord: 369..386
score: 53.7
coord: 240..260
score: 57.14
coord: 197..217
score: 23.81
coord: 319..334
score: 76.82
NoneNo IPR availableGENE3D1.10.287.70coord: 51..157
e-value: 1.1E-19
score: 69.5
NoneNo IPR availableGENE3D3.40.50.720coord: 159..305
e-value: 1.8E-13
score: 50.0
coord: 554..763
e-value: 4.3E-19
score: 68.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 473..493
NoneNo IPR availableSUPERFAMILY81324Voltage-gated potassium channelscoord: 30..172
IPR003929Potassium channel, BK, alpha subunitPFAMPF03493BK_channel_acoord: 297..392
e-value: 2.4E-30
score: 104.5
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 66..149
e-value: 1.9E-16
score: 59.7

Blast
BLAST of TCONS_00000180-protein vs. Swiss-Prot (Human)
Match: KCMA1 (Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 372/948 (39.24%), Postives = 539/948 (56.86%), Query Frame = 0
Query:   20 YRKTSWLGLRFLRIIYAQKAPLMLHYLNVLTAGPNLTMGYVVGKVFALILASAGIIHLLENTGDPWVDGDSNRQKLTYFECVYFMIVTLSTVGYGDFSCNTYLGRVFCMLIIIFGLGLFASYIPMIFDFISSHTKYDRKFKTTPGKKHVVVTGHITDETVSAFVQDFLHPDRAFNNTSVVFLAPNHPTVVIQSILQRYFSKVSYFVGTIYKHHDCERVQMQEADAVIILCDKKCTNPDAEDAGNITRVILVKKFYRHVRCIVQLMRKASKAHIYNCPQWKESNGDAIVCIDELKLGIMAQSCNAPGFSTLLANLFVMRENENKHYQDNWRETYLSGVSVEMYSTLLSDYFIGMSFPKAVEICFTKLNLLLIAVEVHHKDKGEIFAINPSSSLRLTKGSRAFFISQDADDVSKARFYCDRCHTNHTSSKRM------LPK---------------------CKCMSGSSSNVSLEGSFENLKKDHSTTN-GKNHVTVSL-----DNPGY--NNKVTMNGKTLNKFNSSSMKKKTLPPL-------DYKNSKREMFDETGTFFWCPEKLLEDAIMSLEVAEQEMFDGHVVILVISDVRAPSLGLQQLIQPLRASNQPYEDLKKIIILGDDKFLAREWSTINTFPDVHIVTGSPYSRVDLRAVNVHTADMCILLSPFKNVVFEQEEHEAMSDKEVIMVALNLRAMTFDNISKSTLTSPVPYDELPSYKSNFNVQNSFDMLYSENALMAIGTCNLDTNGDTITGENIRMITELVYDSNTLYLDDERQSQCSSEGIWMTQSYACGSVFTVSVLDFLASATYFNQDTLTLVLNLVTGSVNPELDKILAEGKKPDGVLENESIAATRNRCRVDQLSLDDPHFAAMGRINEYGDLFVKSIQEHNMLCLGLYRLHTNSSKTMSLNT-RYVITFPSRDMRLEPTDRVFVLMQFKEDKG 924
            Y   SWLGLRFLR +   +   +L +LN+L    ++ +  ++    +  L +AG IHL+EN+GDPW +   N Q LTY+ECVY ++VT+STVGYGD    T LGR+F +  I+ GL +FASY+P I + I +  KY   +    G+KH+VV GHIT E+VS F++DFLH DR   N  +VFL    P + ++++ +R+F++V ++ G++   HD  RV+++ ADA +IL +K C +PDAEDA NI RVI +K ++  +R I Q+++  +KAH+ N P W    GD  +C+ ELKLG +AQSC A G ST+LANLF MR +  K  +D W++ YL GVS EMY+  LS  F+G+SFP   E+CF KL LL+IA+E    ++     INP + L++ +G+  FFI+ DA +V +A FYC  CH + T  KR+       PK                     C CMSG      + G+ + L++    ++   N  + S      + P      K   NG   N  N+S    +  P L       D  +S  + +D TG F WC  K +E  I++   A   +  GHVV+ +  DV +  +GL+ L+ PLRASN  Y +LK I+ +G  ++L REW T++ FP V I+ G+P SR DLRAVN++  DMC++LS  +N +    +  ++ DKE I+ +LN+++M FD+       +   +      +S+ +      ML   +                 TG NI +ITELV D+N  +LD +      +E +++TQ +ACG+ F VSVLD L SATYFN + LTL+  LVTG   PEL+ ++AE     G        A R+RCRV QL+L D  FA +G    YGDLF K+++ +NMLC G+YRL      T S  T RYVIT P  +  L PTD +F LMQF  + G
Sbjct:  263 YLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPW-ENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMR-SFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSCMSGR-----VRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPS---------------ITTGVNIPIITELVNDTNVQFLDQDDDDDPDTE-LYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG 1183          
The following BLAST results are available for this feature:
BLAST of TCONS_00000180-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
KCMA10.000e+039.24Calcium-activated potassium channel subunit alpha-... [more]
back to top