TCONS_00000104-protein (polypeptide) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000104-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length440

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00000104-protein ID=TCONS_00000104-protein|Name=|organism=Clytia hemisphaerica|type=polypeptide|length=440bp
MVDPLFIFIDLEAAHGNNYFGDIIELAAQVDPRVIENETFSSLINTKQNL
SYFALQISKISREDLRGKQYFGEVFKEFVDWVSKVVSKCDKIKKKKFAPV
LVAHGGFDNDFMMLQSNIDRHEMDLDILNQFRFADTYMLAKRLKCKDIGN
LWKCQLSIEMMYKHFFPDEVFKGQHRALADVKFMIRIFLGSPIAQYFDDI
PIAVFDERKEEYIRKNTSKVEKGLLDENLPKGMAKVTHNMTLNRLLRNGL
TYSRLISFFESAECTFDFYDKLKDMGIERKASKSLAAHLLSLGYCCRGAI
EKEQRNKAGDDEDDKKIQRTDSGYESVHLNDEQWLDRFYTMFVEEFWYGP
EQYEYQYGSITTKEMEEIDIAIDDLFNELFGDDMIDTVGPDGSQVDDSDV
HVKQSSESPVTFIGQVQENNLMLNEDEISNLGLKFGDXDA
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000052XLOC_000052Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00000104TCONS_00000104Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR013520Exonuclease_RNaseT/DNA_pol3
IPR012337RNaseH-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013520Exonuclease, RNase T/DNA polymerase IIISMARTSM00479exoiiienduscoord: 5..195
e-value: 1.3E-4
score: 26.4
IPR013520Exonuclease, RNase T/DNA polymerase IIIPFAMPF00929RNase_Tcoord: 7..188
e-value: 9.1E-11
score: 42.5
IPR012337Ribonuclease H-like domainGENE3D3.30.420.10coord: 5..192
e-value: 8.8E-23
score: 80.6
IPR012337Ribonuclease H-like domainSUPERFAMILY53098Ribonuclease H-likecoord: 6..219
NoneNo IPR availableCDDcd06127DEDDhcoord: 7..189
e-value: 1.95056E-16
score: 75.0296

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00000104-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php