Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97475_cuf2 (polypeptide) - B. lanceolatum

Overview
Nametranscript:BL97475_cuf2
Unique Nametranscript:BL97475_cuf2-protein
Typepolypeptide
OrganismBranchiostoma lanceolatum (Amphioxus)
Sequence length391



Sequence
The following sequences are available for this feature:

polypeptide sequence

>transcript:BL97475_cuf2-protein ID=transcript:BL97475_cuf2-protein|Name=transcript:BL97475_cuf2|organism=Branchiostoma lanceolatum|type=polypeptide|length=391bp
MLYSYDWISVPLVYTQVVTVAVYTFFVSCLMGRQWLDPAKHYPGHEVDLY
IPIFTILQFLFYMGWLKVAEQLINPFGQDDDDFETNWCIDRNLQISYLAV
DDLYMTNPTLERDMYWNQPDPELPYTEASISNRVMTEPFLGSTFDMRLNV
QNMEFTNLHTVAEEPDDNQDSSSTSDNTPVPVPTIVFTEEEDPGKNTTFP
HSSSAPSSPLMSKNAAKSRPRASPRSLRKALLTSKTRAKMEESSLRLKKL
DKKRPLSWGGRCGDDSRSAHRDGPIVTSTEENIADITDAQGHVTNRLEVP
NSQGWGEESVWTEDEGKPLLQVREPPKTHAEAGVWIASRGPGAGPRDHLP
TQDGGPHKTHKHNATNTKDSTRGKNHVLRVDDAELDTVQRL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
gene:BL97475gene:BL97475Branchiostoma lanceolatumgene
This polypeptide derives from the following mRNA feature(s):
Feature NameUnique NameSpeciesType
transcript:BL97475_cuf2transcript:BL97475_cuf2Branchiostoma lanceolatummRNA
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000011genomeSc0000011:893253..895923 -