Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97473_cuf12 (polypeptide) - B. lanceolatum

Overview
Nametranscript:BL97473_cuf12
Unique Nametranscript:BL97473_cuf12-protein
Typepolypeptide
OrganismBranchiostoma lanceolatum (Amphioxus)
Sequence length400



Sequence
The following sequences are available for this feature:

polypeptide sequence

>transcript:BL97473_cuf12-protein ID=transcript:BL97473_cuf12-protein|Name=transcript:BL97473_cuf12|organism=Branchiostoma lanceolatum|type=polypeptide|length=400bp
MAVKAALMFVAVAVLLAYYCDQPVPEGIAEPRMYAKVQGMVFRISANLAR
IGEYLGVGTEPQNLRSVMGAIVNVGLKLKGSSYREGLKVTDTMFDGVKVR
VYEPVSAAQSSSKVPGLVYFHGGGWVILNVDTHDPLTAHVAKQLGTVVVS
VDYRLAPEHVFPAAFDDSVAATKFFLQNAEKYNVDRTRIGISGDSAGGNL
AAAVTLALAKEEDLPKLKTQALINPILQAINFETPSYIAHGHLNTLTKDK
IVSFWLWYLNNDLSFKKVFEANNHTGVQIEKSQYAGYVDPKMVDVTTVKK
ENIKFPEIPNIATILDPHFAPLMADDADLKGLPPTYVMTCEYDVLRDDGV
MYARRLGKAGVEVNHDHYEHGFHAFLNSFDDYELAGIAMQNYLAYLKKIL
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
gene:BL97473gene:BL97473Branchiostoma lanceolatumgene
This polypeptide derives from the following mRNA feature(s):
Feature NameUnique NameSpeciesType
transcript:BL97473_cuf12transcript:BL97473_cuf12Branchiostoma lanceolatummRNA
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000011genomeSc0000011:5264360..5267570 -