Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97472_cuf11 (polypeptide) - B. lanceolatum

Overview
Nametranscript:BL97472_cuf11
Unique Nametranscript:BL97472_cuf11-protein
Typepolypeptide
OrganismBranchiostoma lanceolatum (Amphioxus)
Sequence length841



Sequence
The following sequences are available for this feature:

polypeptide sequence

>transcript:BL97472_cuf11-protein ID=transcript:BL97472_cuf11-protein|Name=transcript:BL97472_cuf11|organism=Branchiostoma lanceolatum|type=polypeptide|length=841bp
GAETGDAFDTEDEDASDSEASDEEDCDSDIEREGEMLYRRLACRDDVTDM
KRTKKRKTKTVDRKAPPADSLELVFVHGYRAHDCRNNLFCTSRGEIVYHV
AAVAILYDKTNHLQRFYLKHTDDIISMVKHPQKDVFATGQVGKDPAIHVW
DGNDLSTLISLQGQHQRGVTALDFSGDGELLASVGLDNDHTIVLWDWKNG
TPLATTRGSKDLLFEIKFNPHNPDKLVTVGKKHINFWTRSGNTFKSKRGI
FGKVGKMTTMLCAEFGRSEADVFSGGANGDIYVWSGNKLLKEVEAHNGPL
NTMKFIPQKGVVVTGGKDGSILQWNDNFERFLKKYNIDRFSETRDSRGVL
LDDRPAVRAVLPAEGRILAGTRSGEVLEIDLSNGLFSILVQGHTGTHLEN
EVWGLDTHPKKHLCVTVSEDKTLRVWDLAADQNQLTRARKLRTGARTCAF
SPDGDLIAVGMNDGGFVIFHCGNLEAASPQFRHRKEKISDLKFSPDGKYI
AVGSHDNFVDVYNVYKMKRTGTCRGSSSYITHLDWDVSGRLLQTNSGAKE
RLFYEVPRCKRVNIPSSELERITWSTWTSVLGPEVQGVWPWYSDVTDVNA
TCLAADKTLLATGDDNGFVKLFNYPATGKHAICKKYVGHSSHVANVRWTY
DDTYLVSAGGMDTSIMVWQRKSSQPRDDGHYDSEDSDVDTDDEDSGDGAG
GVVVEERVAHEMEESYDPNTGKTTYIRTSTVETTIGGQDGQDSPQANGHG
RLTAEQVQEFKEQFEMTDVDGDGLINLADVRKILVRVGYRPSPAEVKEMM
RVVDTSAEKKVDLQTCLSMFSGPKKDKDQDEVKRDSRSGDV
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
gene:BL97472gene:BL97472Branchiostoma lanceolatumgene
This polypeptide derives from the following mRNA feature(s):
Feature NameUnique NameSpeciesType
transcript:BL97472_cuf11transcript:BL97472_cuf11Branchiostoma lanceolatummRNA
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000011genomeSc0000011:1657399..1670132 +