Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97472_cuf11 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97472_cuf11
Unique Nametranscript:BL97472_cuf11
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97472_cuf11

>transcript:BL97472_cuf11-protein ID=transcript:BL97472_cuf11-protein|Name=transcript:BL97472_cuf11|organism=Branchiostoma lanceolatum|type=polypeptide|length=841bp
GAETGDAFDTEDEDASDSEASDEEDCDSDIEREGEMLYRRLACRDDVTDM
KRTKKRKTKTVDRKAPPADSLELVFVHGYRAHDCRNNLFCTSRGEIVYHV
AAVAILYDKTNHLQRFYLKHTDDIISMVKHPQKDVFATGQVGKDPAIHVW
DGNDLSTLISLQGQHQRGVTALDFSGDGELLASVGLDNDHTIVLWDWKNG
TPLATTRGSKDLLFEIKFNPHNPDKLVTVGKKHINFWTRSGNTFKSKRGI
FGKVGKMTTMLCAEFGRSEADVFSGGANGDIYVWSGNKLLKEVEAHNGPL
NTMKFIPQKGVVVTGGKDGSILQWNDNFERFLKKYNIDRFSETRDSRGVL
LDDRPAVRAVLPAEGRILAGTRSGEVLEIDLSNGLFSILVQGHTGTHLEN
EVWGLDTHPKKHLCVTVSEDKTLRVWDLAADQNQLTRARKLRTGARTCAF
SPDGDLIAVGMNDGGFVIFHCGNLEAASPQFRHRKEKISDLKFSPDGKYI
AVGSHDNFVDVYNVYKMKRTGTCRGSSSYITHLDWDVSGRLLQTNSGAKE
RLFYEVPRCKRVNIPSSELERITWSTWTSVLGPEVQGVWPWYSDVTDVNA
TCLAADKTLLATGDDNGFVKLFNYPATGKHAICKKYVGHSSHVANVRWTY
DDTYLVSAGGMDTSIMVWQRKSSQPRDDGHYDSEDSDVDTDDEDSGDGAG
GVVVEERVAHEMEESYDPNTGKTTYIRTSTVETTIGGQDGQDSPQANGHG
RLTAEQVQEFKEQFEMTDVDGDGLINLADVRKILVRVGYRPSPAEVKEMM
RVVDTSAEKKVDLQTCLSMFSGPKKDKDQDEVKRDSRSGDV
Run BLAST on NCBI

mRNA from alignment at Sc0000011:1657399..1671775+

Legend: polypeptideexonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97472_cuf11 ID=transcript:BL97472_cuf11|Name=transcript:BL97472_cuf11|organism=Branchiostoma lanceolatum|type=mRNA|length=14377bp|location=Sequence derived from alignment at Sc0000011:1657399..1671775+ (Branchiostoma lanceolatum)
GGTGCAGAGACCGGAGACGGTGTGTTGTGCAGTGCTTGCAGTGCTGTTGT CTATCATCTTGTCCATTCATCCATTTCACTTCGTCTGCTTGCTTGTTTGT TTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTGCTGTGTTTTGA AGTGTACTGTTGTAATCTCCTAGCAGATCTAACGGTCTACCTTCTACCTT AAACACCCGGTCTTTGCAACCGTTAGATCTGCATGGAGATTATACTGTTG CATCGGCGTGCTTTGTCTTCAAGTTTTGTTCGAATAATCTTTCGTACATA GACACAGTCACACCCGTAAGGACAACATGACCTTTGCAGTCCCTTTTTAT AAGCTATATTCTTTTCCTGTTAACCCAAGACTTAGTAATACTGTTCGTAA AAGTTATCGATTGATATGTTCGTAAATTGATCGATCGATTGATTTTTCGC CGATAGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCT GACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTA CAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGA AGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTG GAGCTCGTCTTCGTGCATGGGTAAGATACTTATACAACGTGCATTTGCTA AACGCCTAATCTACATATACGACATAATTAATAAGATGATAAGTGAAAAA AAGTCTATTTTTGCGTCACATAAAAGCAATAGAAACCACTGTTAGTTCAT ACATGTCATGGATTATGTAGTGTAGAGATTCGAACTATGACATATGTAGA CGAGGAGTTTTTTGGTTTGTTTGCAAGCAATCGTAATTGAACATTATTCG ACGCCCCTCTTAAGTGTGGTGTGCGTGCCTGATGTAATTTTAATGTAAAT CTATGATAATATATTATGCCCCAATCGAGGGTACGTTTTGTACCGCAATG TTATCATAATAGTTTTCATAACAAACATCAGACCATTTCCCTGCCCCTAC CCCTGAGATACCGTGCGCACCTTATAATGACGATTTTGACAACATTCATC TGACCATTTCCATTTCCAAACACCCAACCCCCTAGATACCGTGCGCACGA CTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACG TGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTC TACCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCCGCAGAA AGACGTCTTCGCCACTGGACAGGTACAAAGCATATTCTGTACCTGAACTA TATAACCTAACCGTCCTTGGCGTAATACACCAGCTAATCATGGACTCGTC TTTGTGTTTTGGAATCACCGTCTATTAAGGACGTAACATAGCAGTTGATT ACACCCTGTGTAGAAACATTAAGATTGTGTCTTGGAAGAGAAAACCTTTT GAACCATTCAGCCCAACACGCGGAAGACATCATATCTATGGTCAAATCCC CACAGAACGACGTTTTCGCCACTGGGCAGGTAGATATCACATTCTGTATC TGAGATATATAACCTGTTTGGCCGTCCTTGGCGTAACACACCAGCTAATA ATGTGGACTTGTCATGTTACTGTACTGTTTGTAGCAGGTCGGTAAAGCCC CCCCTCTCACTGGACCCGCGGCACGCTGGCGGCGTCGCTGCGTCCTAAAC TGGATTTGTGTAAGCCTTGAATTTATAATGGGAATATGATTCAAAACCTA CAAATATGACCAAAAAGGCAACAAAACACACAAAGTTTAAAAAGATTCGT TTTTCGTCCATGAAATTCGTTGAGCGCATTGTCAATTTGATCGGCAGCTG CGACGCCACCAGCGTGCCGCGGGTCCAGTGAGGGGGGGGGGGGGTCTTGA GAATCTTGCTATGGACGTTTGGGACGGGAACGACATGTCATGTTACTGTC GACTAGTGTCGTGTCTAACCTGTTCTTGGCTTGTATTTCAGGTCGGTAAG GACCCGGCTATCCACGTGTGGGACGGGAACGACCTGTCACGTTACTGTCC TGTTTCTAACCTGTTCTTGTCCTGTTTTCCACGTCGGTAAGGACCCGGCT ATCCACGTGTGGGACGGGAACGACCTGTCACGTTACTGTCCTATTTCTAA CCTGTTATTGGCTTGTTTTCCAGGTCGGTAAGGACCCGGCTATCCATGTG TGGGACGGCAATGACCTGTCACGTTACTGTCGTTTCTAACCTGTTCTTGT CCTGTATTCCAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAA CGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCA CCGCACTCGACTTCTCAGGTCAGCTCACCACCTTTAAACGTATCCACGTG GCACGCCGCCATTTTGGTGTCTAAAGCATTTCTTTTGACCTCGGTTCTCG CTTTTATATCTAGAGATCGTGCGAATCTTGCTGAAAATGAACAAGTGTCT GAATCGTAAAGAACAAGAGAATGTGTTCGAAAGAAACCTCATCTGTGTTG GTAAAGTACATATTGTAAAGTTTTGAGCTTTGAACCAACAGAAAGATGGA ACTCACCGTGAATTTTCGCTCGGAACTCCAACCTTCCTCAGATGGTTTGA AGACGCTTAAAACTTTACAAAAAAGATTGTGTGTCCTACCAGGTAAAATT TACTGGCACACAAATCGACGCCTACACAGCGAATATCGTTGATACGGCAC CTCTCAATTGATATATGAATCAATATTACCTAAGTCGGTGCGACAGCTAA CTGGGGACATTCTTAGGGTAGTCGTGGATGCACCATACAAAATTCAGCTG TCTTGTGAAGGAAAGGGTTGCCTTAGATCGTTTTAGACAGTTGGTTCTGT TCCGTTGGGAGACATTGAAGGAAGTAAGGACCATTTTGTTATGGTGACTC ATTTCATGATAATGCACAAAAAGAGAAGTCGATTCAGACCACAAAAATGT ATCACAATTTGTCTAAGCTTATAGAGAAACAAAAGACTATTCTTCTTTTA ACTATCCAAAACCCACATATTTTCGAAAAGGACATTACGTCTTCCATTGC TTACAAAAGAGAGGTCAAACCATTCACTAGTTATAGACAATCACGTTTTT ATGATTTAGTTTACCCGCTTTTATACTTATTTTGTACCCTGTTCTTTTAT CGATGTCATTTGCAATTAGCTTTCGGGCAGGAATTTGCAATAAACTTGTT ATGATTATTTTAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAA CGACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCA CGACAAGGTAAGAAAAAAAGTGTCAGAATTTAGATTCTCCGATCGTTCAT CACGTGTTATCAAGGTCAAGGTTTCCTTCGTCAAAGTGTAGAAATGCAAA GCATTCTTATTGCTGAACTACGAGCGGCGTTAGGCTTGTAGTTCGATCGA ATCATATCGAAGTGTACAACGGGTCCTACTCGTATCGAAAAGATTGGTGG GTTCTCCAACGTGTATGAAATGTGACTATCCTTAACCACGGAACCTTCAT CAGAAGTGAACATAGCTGACAGACCACGGGCTTGACGCCCCCTGGAACAG TACCTCCTAAAAGTAGCGTGCTAACCTATGGGGCAAGGCCAAAAATGGAA AGATATAACAATCGAATGTTCCGCTACCGTGCAGTAGAAAGCCACTAGAA GGTCCATTGTCAAAGTCGACCTTCGTATTTTCCGAAACCTACCCATTTAC CAAATATCATCAAGATACATCCACAGCTTCTAGTGTTATGCTGTCCACAA ACAAACATATCCAATCACAAACCCAGCCAGAAGTAAGAAAAAAACGCAAC TTTCTTGGCAAAGGTTATAAGGTATCTAACTGAAACCCCTCGTATGTTTT ACGTGACTTCAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACC CGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTC TGGACAAGATCAGGTGAGAAAAGGATTATAATTATTTTGCATTTCTATCA TTCTGATTTCAACAAACATAATCTTTACAACTTTTGATGGCTTAATTTGG ATTTCCCTTTATGCCAAAAATCAAGACGAATAAATGAACCCATATATAGT GATACATGTATCAACTGAAAGACTTAAAAATAGCAAAGTACATCTCATGC TGTCTGGTTATCAAAGTATTACATTGTCAACAATCGCAATAGTTTGTCAC CTTCGAAACACGCACAAAGAAAATGGCAAAACTTTCAAGCAATTAAATAC TGACCACTCTATGTTTGCTTGTTTAATCATCCTATTGTCATCGTCAAAGA TATGGGGTTTGTATCAATCATTTTGAATTTGGCCACCCCAGGAAACACCT TCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATG CTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGC CAATGGAGACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCG AAGCGCACAACGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGTT TCTAATGTTTAACATTTATTTTTCGTTAACCGATCACCGACAATACACGT AAAAAAGGTCCCATTTTTTGCCTATACGGTGATCAAGTTTAGATTTGTGT GGACGATTATGTTGAAATTGGAATGTCATTCATGATGTAAAAGTATAATT TGAAAGGCGTAGAAACGTCAACATGAAAAGATTCGTCATTCATACATGAA ATTCGTTGAGAGACCTGTCAGATCTTTGCTCGCTCAACTGTCGTTCAGCC TCAGGTTGTAGCCTCTAGTAGACATGGGTTGTAACGGTATGATGTCCAAT CTATTGGAAGGGTTTTTCATCTCTTCAACACTTAATCAGTTAATTGCGCC AAAATCATCTCTGTGCAAATATGTTGGCAAGAGATGTCACGTGTTGTCAA GAGTTACGTCATTTGGTCTTAACCTATCTAAGAAATGGTTGCATTTTTTG CCCTCTAGATCCTTTTGTAGATACTGCTTTGTGCTAAGATGTTTCTCAAC GTTGATTTTCATCCGCAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTC CATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACA TCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGAT CGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGG TACCCGGAGCGGCGAGGTGCTGGAGATCGACCTAAGCAACGGGCTCTTCT CCATTCTGGTGCAGGTAAGGGATGACTAGCCTCCACAAGGCCCTCATAAG GGCGTATGGATAGTAGAATTCGGCAGAAAAAGGAATAATGGACCGTTCCA GTCGAACACCATAGGCCCCACCCCTGTTCTATTTCGAACACCAAATAGAA CAAGTGGTTCTATATGTTCGATATAGTGTTCGACGGGAACGGTCCATTGG CATCTGATCGGCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGACGCATC CTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGG GCTCTTCTCCATTCTGGTGCAGGTAAGGGATGATCATCATCAAGGCCGGT TGCTTACCCGAACTAAGTAGATAATAATCAGCAAGCTGCTATTGTCGCGA CATGTGCTGAAGAAAGATGCATCTTGGCTCAGACAAATTAAGACATCAGC ACTGAACGGTCTACGGAGCTTTGCCACGTTCTGTCTTCTTTCTCTTCGTC CCTCTATCCTTGTTTAGGGGCCAGAGGCATTGACACACACCGTTGGAAAT CAGATGTTTTTATCTATTCCCTGTATATGTTCATTCATTCATTCCTCCAT TTTTTCATTTTCTCCATCCCTTCCTCGGGCCACGTGGGTACGCACCTTGA GAACGAGGTCTGGGGTCTCGACACGCACATCTGAAGAAAATGATGTTTCT TTGTCTATTCCTTCTTGTTTTCATTTATTCATTCCTCCATTCATTTCTTC CCTCCATCACGTCCTAGGGCCACACGGGCACGCACCTTGAGAACGAGGTC TGGGGCCTGGACACGCACCCTAAGAAACACCTGTGCGTCACGGTGAGCGA GGACAAGACGCTGCGTCTTCTCTTTTTAATTCATTCCTTCTCTCCATCCC TTCCCAGGGCCACACAGGCACGCATCTTGAGAACGAGGTCTGGGGTCTGG ACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACG CTGCGTCTTCTCTTTTTAATTCATTCCTTCTCTCCATCCCTTCCCAGGGC CACACGGGTACACATCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCC TAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGT GGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGG ACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGT GGGCATGAACGATGGTAAGGGCTTCAAGAATTTTCTGAATGGATGGCTGA CGGGTTTGATATCTCGTGTTCTGGACATGCTTTGGTCATGACTTTTGAGT GGTAGATAGTTCTTGGGAGGGGGAGTAAGTTGTGTAGGTGTGGCTTTCTA GCAGCTTTTTTTGGAACTGCAGGAGCCGATTTCGTTTCAAACTTTGAAAG GGAATAAATCAAGAAAGGGTGGACGGATCGACATGGTATTTAGTATGTAG ATAGCTTTGAGTGATGCTTGTTTTCATTTGATCTACGCGAAAATACTCAC ACCCCTTCCCTCACATACGCAGGAGGGTTCGTGATCTTTCACTGCGGGAA CCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTG ACCTCAAGTTTTCACCAGGTAAGCTCTTGTACTAATTTCCAACGGCTATC ATTTTTATTAATATTGATGACTTATTAATGTTTAAATATTGCTGTTATAA CAAACGAGGTTTATATGAATTTTGATTATTTTTTATGCCTTTTCGGTTGA AGATTCAGAGGAAAATTTGTGTAATGGGCGCTTGTTCTTTCTGTTTTATC AAGAGTTAGAAACTTACCGCACGTCTTATCTTGCCTATACAGATGGGAAG TACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTA CAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCC ACTTGGACTGGGATGTCAGCGGTACGTAATAAAAAACAACAACAACAAAG AAACAAACAAACATCCGTTCAGGTCACGTGACTTAAGCTTTGGGTCGTTT CTACTTGAGAAGAATCAGACGACTGACCAAAACCTCGTTGGTAAACGCTT TACTTTGTGTATGAAAACGGCGTTTAAAAGCTGGTAATAACAATATTTTT GTCAATGATTTCGCCCAGGCCGTCTGCTACAGACCAACTCCGGCGCGAAG GAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAG CTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGAC CGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAAC GCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAA CGGATTCGTCAAGCTATTCAACTACCCTGCAACGGTAAGCTGGTTTGAAA GGAAGTGGCCATGATTTTGCTTATCATGTAATAAGCACATTAAAATACCT GTCGTATATGTAGCACACAAACTCAACAGGATACTCAAAACGTAGACTTA GCTCGAAGATAAGTTACATGTTCAAATAGCAGCCATGTTTTATTTCAGCG CAATAAAACCAAAGAACAAAAGGTAGTAAGAAATGATGGCCTAAACTGTC TCTTTTAACAATTCTTTTAGTTTCAGTCCAGATAATCTAAGATTTTCGCA TTTTCGTGCAGGCCATGGTAAGGTGAAAGCTTTTGTTACATTTTCATTAT TCCTTTATGCTATCAATAATGCGACTGATTGTTTCTTATATTAAACGAAA CCGTATATTTCCAGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCAC AGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGGT GTCAGCAGGTGGGATGCGAATTCATTCATTGGATGGAAACTAACATTATG GTCTGGTAGAGGGGACACGATTAAAACAGAAACCCATTCGCGATCTCACT ACATAATACAAAGGTTTCAAATATTAAAACAACACAGCGATAAAGCACTC ACCAAACCAGTTTGCTCCATTATGTAAATTTTGTTTATCTCAGTGTTAAT GAGAGCCGTAAGATCCGTATAGAAATACTATTAAAGTATTCTATATTGTT GATCCCTACTGCATTGACACTTAAGAAGGAAATTGAGGAGGATGTTGGTC TTAAAGCTTAAAGATGAAGATCTCCGATCTGTCATGCTCGTCAGTAACAT GTGGAGACATTTGTGTCACTTCAAAGAGGATGAACTGAACTGAACTGCAT ATTATGAAAAATGTGATTCGTACTGATATACTGTCTAATGATATAAAATG TTAGGTAAATTTATTTATTTATTTATTTGTATCAGGCCCATGGCCCATAA AAACAGACACAGAACAAAGATTTACAAAGCTACACTTACAAATACTTTAC ATAATGTCGCCAGAATGTGCTATGCCTATGGCAAAAGCCGTCCGAGTGTA CAAGCACTCTAATTATATCATTGTCAGACGACAGCAGGCGTGTTACAAAT GAGTAGGTGACCTTGCGACGCCTTGCGTCAAACATGTCGGTCCGGTTATT CACAAACAACCAACTAGTGCTTGTATGCCTGCCGACGGAAAAAAGCATTT TCATTGCGCTGTGGTAAGCCACTCGTAGCTTGGAGATCGCACTCACGCTG TAATTACTCCAGATTTGGGCACAATACATCGGGGAGCAATACGCTGAGAA CAACTCACTTTTTACCGCCGCTGAGCAGTAACGAAACCGCCGGAGGAGTG AGTTTGCCCGAGAATAAAAGCCTCTGACGTGAGCTCGGATTGCTGCGTCA TCCGAAAGATCAGGGGTAATTATATACCCAAGATATGTGGTAGAAGAGGC ATACTTTAAGGCGGTACCGTACAGCATCAGCGGCNCGTGAGCTCGGATTG CTGCGTCATCCGAAAGATCAGGGGTAATTATATACCCAAGATATGTGGTA GAAGAGGCATACTTTAAGGCGGAACCGTACGTCATCAGCGGCGGCAAAGG CATACTCATGCGGAAGCGGCGACACGGAAAGTACATACATAGTGTTTTCG ATTCATTAAACAACATGTCAATATCCGCTCCAGATAGCTCACAAATACTG ATCAGTCTCTGCAACGCTTTAACAGACGGACAGACGAGGCAAATGTCATC CGCGTACATCAAGTGGTTGACTAAGGTGTCCCCAACATAGCAACCAACTC CAGACCTCAGTAGCTCGGTACTCAAATCGGATACATACACATTGAACAAG ATTGGTGACNAACTGTAAAACTCATCTTTCTGTATTCAATGATGTTTAAC TGATTGTGAATATGATACCCATCTACAGGAGGTATGGACACGTCCATCAT GGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGACA GCGAGGACTCGGACGTCGACACGGACGACGAAGGTAAAGAATAGCCTCTA CCAGGCTCCAGAGGCGGCTGGAAGTTTAGAAATTGGCCAAATAGACAGAA AAACATGCAAGAGAGGTTAGTCTGCTATAGGGGTACAGTTTGCCGCATAT TGGACCCTCCCTCCGTAGCCGACTGCCTTAGCATACCATTCACTCTATTT GGCCAATTTCTACTATTTTTCCAGCCATCTACGGGGCTTGGTACAGGCTA GGTAAAGAGTAGTGTTGAAACAAATTCACATGGTTGTGTAGTTAATGCCA ATAAAGCATTCATCCATTCATTGTTCCATCCGTCTATCCATCCATCCATC TATTCATTCATCTATCCATGCAGTTGATTTCGATTATTCTATAAAATGTC ATTGGTTTATTTCGTTGATATCAAAAGATTAGTCATTGATTAATATATTT ATTTACGTAATTTTATTTCATTCATTAATTCATGCATTCATTTTCTGATC TCTACTAGTGAGTGCACTGCACATGCATACGTGTATCGCTAGTTTTCATT CATACATTCATTCATGTATCCATCACTTTATCTATCTATTAATCTACTTG ATTCAGAATGATGATGATGATGATGATGAAAAAATTCTCTATCTATCCAC CCATTCATTAATCATTTCATTCATTGGATTAATCAATTAGATGTCGATAA TCAATTGTCTATCCTCCCAGACTCCGGTGACGGTGCGGGCGGCGTGGTTG TCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACG GGCAAGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGG GCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAG CGGAACAAGTACAAGGTACGGACATTCACTGTGTAATTATTTAACCCATT TCACCCCGCGTCTTTCCCCCTACTTTGCCCCTGATGGCGATATATTGGGG TACCAACAAGGTAAATGTATTGAGGTGCCACCTGAGATCAGCCTTACCTA ATTTAGCACAATAGATAGGTAGCCGTCCTAAATTCAGCGTAACTAAAGCA TTTAGTAAGTCTTAAACACCTTTACTTTCTTCTTTCTAGTGTCTTAGATA AGTAATATAGCGTGAATTTGGATGCAATTACCTTTGATCACAAGCAAAAT TTATAACTTTTCGTCAACTTGCCAATGAACTTTTTGCCAAAAGGTGACAG GTGCAAAACGTTTCCTTGTGTTAGAAATAACTTCATTTGACGTATTTAAC CTAAACGTCTTGCCCTTCAGAGTTTAAGGAGCAGTTCGAGATGACGGACG TGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTC AGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGT CGTGGACACCAGCGGTAAGTCTTTGATATACTCAATGACTGTTGATGTAA ACAGGTCGTAGATTTTATTTAAACTTCGACAGGTGTGTAGTACTGTGTCT CTCTTCAATAAGATCCAGCCAACATCTCCCATGTAACATTGCAATCGTTC AACTCTTCTTTCTTCTTTCTAAGACATAACAATGTTTTCGTCTTTGACAC ATAACCGCTCCCAAGCTATGAAATCCATACGTTTGTCACATCTAACCCTG CCAAAGACCTCTACTGAAAGAGATGTGCATATAGTCATAGACTACTGATG ACATCACTGCTTCATACTTTGTAAGTGAGCTCAGATGGTGGATGCAAACA GCTATCAGAGGCCTTGTCCGTTCCCCGCTGAACTTTAACCGTGCTCCCTT TGTTACAAACAGCTAACTTAAACCTCTTCCCAAGCTAGCCTCCATAGCAG GCTCTGAACCGGCCTTTTTGGGGGCTAAATAATACACCTTTTGCAGCCAG CCCGTAACCATCAGCCACCCCGTAACCATTTTGCCGGTAGAGCCTGCATT ATAACGGTGGGTCAAAGCGGTTACGGGGGCGGCTGATGGTTACGGGCTGG CTGCTAAAGGTGTATTATTTAGCCCCCAAAAAGGCCGGTTCAGAGCCTGC TATGGAGGCTATTCCCAAGCTACTTTCCTCATAAAACTGTAGAACTAATA CTGATCTTAGTCTTACTAACCCTGATTGTGTCCTGACTCTGTGCACCCTC CAGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGC CCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGTGATAAATGTTATG ACAATCTGTGAGGGGTGACCTACGGGATAAAGTTGGGAATGCACAATATG TCCCCTCTTTTTAGACAAGCCCATTTGCACGCACACTAACAAAGCGCACT GTCGTTCCTTCTCGCTTGTTCTCCTTTAAATGTGCACATTTTGTAACTTC CGTTACTGTTTGAAGTAAGACGTTTCTGACATTAAGATATGCCACATATA AGGTGCCAAACTGTCGTTTTTAAAAGCCAGAAAAGTTTTAAGTCGTCAAA AAACGACAGTTTGGCACCTCATATGTGGCATATCTTAATGTCAGGAACGT CTGACTTCAAACGGTAACCCAAGTTACAAAATGTGTACATTGAAACGAGA ACAAGCGTTCTATCTTCGGTTCAAGAACTCTCAAATTGCTGGTTTAAGGC ACCTCATAATACACCAATCTTGAAAACCGTGTTTCTGACATGTTTTCTGC CACCCACAGGGACAGTCGAAGTGGTGACGTTTGAGGAGTTTTTGGATATG ATGGACACGTTTTACCACCGTGAGTGAGAGTGCGAGAGCACAACAAGATG CACACACTGTGGACTGATTAACGTGACAGTATGGATCGGTACATCTGCTT CAGAACCACCAGGAGGGTGAATTGAACCTCAGTCATCCCTAACACAGCAG CGACACCTAGCGGCAGTGCAAAGTAGAACAAGTCAGTTGTACTCTGGAAA GGGTAAAATACGGTCCACCAACTTTATTTGTGTGAGAAGAACTGTGTGAA GCATCGGTCTACCAACATCGTTAACTCATGATCGTGCACCGTGCACGCAG TTAAACATATCTGAAATAATGTCATATCAGTAATACCATGTAAATAATGT CATATCAGTAATACCATAGTTCAAAGTCTTGTTATTATTCCCTTTAACCT ATTCGCTGCAGTTTTAATCGGTTCTGTAATGTTTATAGTTAATCTGTAAT GGTTTCATCTATTGATAATGTAACGGATTCTTCAACGCCTGCTGTGCTGC ACTAAGTCGTTAGAGGGCGTTTCTTTAATGTTAGCATTTCGTAAGAGCGT TTAAACGTGATCTATTTGCACTGCGGCGTTTGCAGATGTATGTATAGAGG AGGTCGAGGTCACAATGTTTCTATGTATTGTGTATTTAATGGTTATTTTT GGGTGCCACTTGGTGTAAATATATACATATATGTTTTGAATGCATTACGT ACGACCATATCAATTCATTTCTTTGGTGTTCGGATTCAGATAAAGAGTAC AAAATTGGAAATTCCACATAAAGATAGAGTCAGAGGGGGAGCAGTACGTT CGTTCACTCAGTTCCCGAGAGTAAATGTTGTCAGCTTCAACTTTACCTTC CAGTACTCTGTCTTTATGTTATTAACATGATGAGATTACACTTCAAAATG TCATTGAACCAAGAAATGAATCGTTGTGGCCTAAATTGATAATGGGTAAG GTTAAGTTTGTATTACATTTTGTGAAAAAAACTTACTGTCACGTAGGTGT TCGTAAAAAATTGTGACGTCATCAATTGGCCATTTCGTACATGTTCGTAC ATGTTCGGCACGTGTTCGTGTGACGTCATCTTCGGACTCGACAGCGGGAT AAGAGTGTTGGGAGGGGGGTAGATAAGTCTCTTTTGAAGCTAGAGATAAA GTCGTCTGTATCTTTTATGAGATAGGTTGTATTTGAAAATTCCCTTTGCT TGTTATTTAGAATAGTTAGAGCCACATAGGAGGAAAGCCATGCTATTTGT ATAAACTGTATAATGTGCACAGATATCTATATCTATATACTATGATAAAT TGCGTATGTAACATGTATATATACCCATCAATGACTCACTATTGTAAAGT CCAGACATTTTGCCTGGGAGTAAAATGGTTTGCAGTACTTGTCAAACACT ACGTTGTATTATTGGAGATACATGTGTGTTTAAGGGTTTAGAAAATTCAC TGAATTTTGGTTGATGTGAAAGTTTTGAAATTAATGACTTGGAATCTTCC GGTATTATCTTCCGGTTCTTGTCTGTGGGGTTAGGTCGACAGGCTGAAAC TACAGGCTGCATATCTTTGTACAATTGATTCAGCAGATATATATTAAATA CATGGTGTTTTTGTGTTTATGAGTATT

Coding sequence (CDS) from alignment at Sc0000011:1657399..1671775+

>transcript:BL97472_cuf11 ID=transcript:BL97472_cuf11|Name=transcript:BL97472_cuf11|organism=Branchiostoma lanceolatum|type=CDS|length=50520bp|location=Sequence derived from alignment at Sc0000011:1657399..1671775+ (Branchiostoma lanceolatum)
GGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAGATGCCAGCGA
CTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATCGAACGCGAGG
GGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATG
AAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCC
TGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGACT
GCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTG
GCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTCTA
CCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCCGCAGAAAG
ACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGG
GACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCG
CGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCG
TGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTGGAAAAACGGC
ACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAA
GTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACA
TCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATC
TTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCG
CTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCT
GGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTT
AACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAA
GGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGA
AGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTG
CTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCAT
CCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACG
GGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGAAC
GAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGACGGT
GAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACC
AGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTC
TCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGT
GATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACC
GGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGGGAAGTACATC
GCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTACAAGAT
GAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGG
ACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAG
CGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTC
CGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGG
AAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAACGCC
ACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAACGG
ATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCACGCGATCTGTA
AGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGGACGTAT
GACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCATGGT
GTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGACAGCG
AGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGACGGTGCGGGC
GGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGA
CCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACCGTGGAGACCA
CCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGC
AGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGAC
GGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCC
TGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATG
CGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCT
TAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGA
GGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAGACGCCTTT
GATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGA
CTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTACAGGCGGCTGG
CGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAAGAGAAAAACC
AAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTT
CGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTATTCTGCACGA
GTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGATCCTGTACGAC
AAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGGATGACATCAT
CTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACTGGACAGGTCG
GTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCTCAGCACGCTC
ATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCACTCGACTTCTC
AGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGACCACACCA
TCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCACGACAAGGGGC
AGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACAACCCCGATAA
GCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACAAGATCAGGAA
ACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACC
ACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGG
GGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGG
AGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTTCATCCCGCAG
AAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAA
CGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGACCGGTTCTCGG
AGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGC
GCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGA
GGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGG
GCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCTGGACACGCAC
CCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGT
GTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGC
GGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACCTGATCGCG
GTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCGGGAACCTTGA
AGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTGACCTCA
AGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCATGACAACTTT
GTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCACTTGCAGGGG
GTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGCGGCCGTCTGC
TACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGG
TGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCATCACGTGGTC
CACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGT
ACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGCGGACAAGACG
CTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTATTCAACTACCC
TGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCACAGCAGTC
ACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGGTGTCAGCA
GGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCC
GCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTCGACACGGACG
ACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTT
GCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCAAGACCACCTA
CATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAAGACGGCCAGG
ACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGAACAAGTACAA
GAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAGACGGGCTGAT
AAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGACCTT
CACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACACCAGCGCTGAA
AAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGCCCCAAGAA
GGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTT
GAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAGATGCCAGC
GACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATCGAACGCGA
GGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATA
TGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCC
CCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGA
CTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACG
TGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTC
TACCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCCGCAGAA
AGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGT
GGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAG
CGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAG
CGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTGGAAAAACG
GCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATC
AAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCA
CATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTA
TCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGT
CGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGT
CTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTC
TTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGG
AAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAA
GAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGC
TGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGC
ATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAA
CGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGA
ACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGACG
GTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAA
CCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCT
TCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATGGAGGGTTC
GTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCA
CCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGGGAAGTACA
TCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTACAAG
ATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCCACTT
GGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGG
AGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGC
TCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGACC
GGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAACG
CCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAAC
GGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCACGCGATCTG
TAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGGACGT
ATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCATG
GTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGACAG
CGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGACGGTGCGG
GCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTAC
GACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACCGTGGAGAC
CACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACG
GCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATG
ACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGAT
CCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGA
TGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGC
CTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAA
GAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAGACGCCT
TTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTGACGAGGAG
GACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTACAGGCGGCT
GGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAAGAGAAAAA
CCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTC
TTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTATTCTGCAC
GAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGATCCTGTACG
ACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGGATGACATC
ATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACTGGACAGGT
CGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCTCAGCACGC
TCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCACTCGACTTC
TCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGACCACAC
CATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCACGACAAGGG
GCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACAACCCCGAT
AAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACAAGATCAGG
AAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGA
CCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGC
GGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAACTCCTTAA
GGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTTCATCCCGC
AGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCCTGCAGTGG
AACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGACCGGTTCTC
GGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCC
GCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGC
GAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCA
GGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCTGGACACGC
ACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGC
GTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCT
GCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACCTGATCG
CGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCGGGAACCTT
GAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTGACCT
CAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCATGACAACT
TTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCACTTGCAGG
GGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGCGGCCGTCT
GCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGC
GGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCATCACGTGG
TCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTG
GTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGCGGACAAGA
CGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTATTCAACTAC
CCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCACAGCAG
TCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGGTGTCAG
CAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAG
CCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTCGACACGGA
CGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCG
TTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCAAGACCACC
TACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAAGACGGCCA
GGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGAACAAGTAC
AAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAGACGGGCTG
ATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGACC
TTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACACCAGCGCTG
AAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGCCCCAAG
AAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGT
TTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAGATGCCA
GCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATCGAACGC
GAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGA
TATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGC
CCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCAC
GACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCA
CGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCT
TCTACCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCCGCAG
AAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCCACGT
GTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATC
AGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCT
AGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTGGAAAAA
CGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGA
TCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAG
CACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGG
TATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCG
GTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCTAC
GTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACC
TCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCG
GGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTG
AAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGT
GCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGC
GCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGC
AACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCACCTTGA
GAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGA
CGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAG
AACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGC
CTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATGGAGGGT
TCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGC
CACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGGGAAGTA
CATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTACA
AGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCCAC
TTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAA
GGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCA
GCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGA
CCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAA
CGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACA
ACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCACGCGATC
TGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGGAC
GTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCA
TGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGAC
AGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGACGGTGC
GGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTT
ACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACCGTGGAG
ACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCA
CGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGA
TGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAG
ATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGAT
GATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACAT
GCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTG
AAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAGACGC
CTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTGACGAGG
AGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTACAGGCGG
CTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAAGAGAAA
AACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCG
TCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTATTCTGC
ACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGATCCTGTA
CGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGGATGACA
TCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACTGGACAG
GTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCTCAGCAC
GCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCACTCGACT
TCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGACCAC
ACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCACGACAAG
GGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACAACCCCG
ATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACAAGATCA
GGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGAT
GACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCA
GCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAACTCCTT
AAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTTCATCCC
GCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCCTGCAGT
GGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGACCGGTTC
TCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGT
CCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCG
GCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATTCTGGTG
CAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCTGGACAC
GCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGC
GCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAG
CTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACCTGAT
CGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCGGGAACC
TTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTGAC
CTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCATGACAA
CTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCACTTGCA
GGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGCGGCCGT
CTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCC
GCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCATCACGT
GGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCG
TGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGCGGACAA
GACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTATTCAACT
ACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCACAGC
AGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGGTGTC
AGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCC
AGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTCGACACG
GACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCG
CGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCAAGACCA
CCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAAGACGGC
CAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGAACAAGT
ACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAGACGGGC
TGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGA
CCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACACCAGCGC
TGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGCCCCA
AGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTGAC
GTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAGATGC
CAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATCGAAC
GCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACC
GATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGC
GCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGC
ACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTAC
CACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCG
CTTCTACCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCCGC
AGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCCAC
GTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCA
TCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGG
CTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTGGAAA
AACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGA
GATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGA
AGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGA
GGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTT
CGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCT
ACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGA
CCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGG
CGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCC
TGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGG
GTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGG
GCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGA
GCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCACCTT
GAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGT
GACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACC
AGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGC
GCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATGGAGG
GTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCC
GCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGGGAAG
TACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTA
CAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCC
ACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCG
AAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCC
CAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGG
GACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTA
AACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGA
CAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCACGCGA
TCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGG
ACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCCAT
CATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACG
ACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGACGGT
GCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAG
TTACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACCGTGG
AGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGG
CACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGA
GATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGA
AGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAG
ATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGAC
ATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAG
TGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAGAC
GCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTGACGA
GGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTACAGGC
GGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAAGAGA
AAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCT
CGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTATTCT
GCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGATCCTG
TACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGGATGA
CATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACTGGAC
AGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCTCAGC
ACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCACTCGA
CTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGACC
ACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCACGACA
AGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACAACCC
CGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACAAGAT
CAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAG
ATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTT
CAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAACTCC
TTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTTCATC
CCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCCTGCA
GTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGACCGGT
TCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCG
GTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAG
CGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATTCTGG
TGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCTGGAC
ACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCT
GCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGA
AGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACCTG
ATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCGGGAA
CCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTG
ACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCATGAC
AACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCACTTG
CAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGCGGCC
GTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTC
CCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCATCAC
GTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGC
CGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGCGGAC
AAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTATTCAA
CTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCACA
GCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGGTG
TCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGTCGTC
CCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTCGACA
CGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAG
CGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCAAGAC
CACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAAGACG
GCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGAACAA
GTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAGACGG
GCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTACC
GACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACACCAGC
GCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGCCC
CAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTG
ACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAGAT
GCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATCGA
ACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCA
CCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAA
GCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGC
GCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGT
ACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGCAG
CGCTTCTACCTCAAACACACGGATGACATCATCTCTATGGTCAAACACCC
GCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCC
ACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAG
CATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCT
GGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTGGA
AAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTT
GAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAA
GAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGC
GAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAG
TTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACAT
CTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACG
GACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACC
GGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTT
CCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCG
GGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAG
GGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCT
GAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCACC
TTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGC
GTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGA
CCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACAT
GCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATGGA
GGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTT
CCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGGGA
AGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACGTG
TACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATCAC
CCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCG
CGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATC
CCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTTCT
GGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACG
TAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGAC
GACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCACGC
GATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGAT
GGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCC
ATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTA
CGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGACG
GTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAG
AGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACCGT
GGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACG
GGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTC
GAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTCAG
GAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGG
AGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAG
ACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGA
AGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAG
ACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTGAC
GAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTACAG
GCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAAGA
GAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAG
CTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTATT
CTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGATCC
TGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGGAT
GACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACTGG
ACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCTCA
GCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCACTC
GACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGA
CCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCACGA
CAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACAAC
CCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACAAG
ATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGA
AGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTG
TTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAACT
CCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTTCA
TCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCCTG
CAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGACCG
GTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCCGG
CGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGG
AGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATTCT
GGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCTGG
ACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGACG
CTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCGCG
GAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGACC
TGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCGGG
AACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATATC
TGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCATG
ACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCACT
TGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGCGG
CCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGG
TCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCATC
ACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTG
GCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGCGG
ACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTATTC
AACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGGCA
CAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCTGG
TGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGTCG
TCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTCGA
CACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGG
AGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCAAG
ACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAAGA
CGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGAAC
AAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAGAC
GGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTA
CCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACACCA
GCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAGGC
CCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGG
TGACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGAAG
ATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACATC
GAACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGATGT
CACCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAGAA
AAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACCGT
GCGCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATCGT
GTACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCTGC
AGCGCTTCTACCTCAAACACACGGATGACATCATCTCTATGGTCAAACAC
CCGCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCTAT
CCACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGGCC
AGCATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGCTG
CTGGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGATTG
GAAAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCTGT
TTGAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCGGC
AAGAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCCAA
GCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGCGG
AGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAGAC
ATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCACAA
CGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGA
CCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGCGG
TTCCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCCCG
CGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCG
AGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCGAC
CTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACGCA
CCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCTGT
GCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGGCG
GACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCAC
ATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGATG
GAGGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTCAG
TTCCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGATGG
GAAGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAACG
TGTACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACATC
ACCCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCCGG
CGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACA
TCCCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCGTT
CTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACGGA
CGTAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGGAG
ACGACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGCAC
GCGATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTGCG
ATGGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACACGT
CCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGACAC
TACGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGTGA
CGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGG
AGAGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCACC
GTGGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAA
CGGGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGT
TCGAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACGTC
AGGAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTCAA
GGAGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCTTC
AGACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAGAC
GAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACCGG
AGACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTCTG
ACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGTAC
AGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAGAA
GAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCTGG
AGCTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACCTA
TTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCGAT
CCTGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACACGG
ATGACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCACT
GGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGACCT
CAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGCAC
TCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACAAC
GACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCCAC
GACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCACA
ACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGACA
AGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTGGG
GAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGACG
TGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACAAA
CTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAGTT
CATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCATCC
TGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCGAC
CGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGCCC
GGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTACCC
GGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCATT
CTGGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGTCT
GGACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAAGA
CGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCGCG
CGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGCGA
CCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTGCG
GGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAATA
TCTGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCCCA
TGACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGGCA
CTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCAGC
GGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTACGA
GGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACGCA
TCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGGTG
TGGCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCCGC
GGACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCTAT
TCAACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGGGG
CACAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTACCT
GGTGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAAGT
CGTCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACGTC
GACACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTCGA
GGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGGCA
AGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGCAA
GACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCGGA
ACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGGAG
ACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCGGG
TACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGACAC
CAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTCAG
GCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAAGT
GGTGACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGACGA
AGATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGACA
TCGAACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATGAT
GTCACCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGACAG
AAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATACC
GTGCGCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGATC
GTGTACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCATCT
GCAGCGCTTCTACCTCAAACACACGGATGACATCATCTCTATGGTCAAAC
ACCCGCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGGCT
ATCCACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAGGG
CCAGCATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGAGC
TGCTGGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGGAT
TGGAAAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTGCT
GTTTGAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGTCG
GCAAGAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGTCC
AAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGCGC
GGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGGAG
ACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGCAC
AACGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTGGT
GACCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGAGC
GGTTCCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACTCC
CGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCCGC
CGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGATCG
ACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCACG
CACCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCACCT
GTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGCGG
CGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGCGC
ACATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAACGA
TGGAGGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACCTC
AGTTCCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAGAT
GGGAAGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTACAA
CGTGTACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTACA
TCACCCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACTCC
GGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTCAA
CATCCCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTCCG
TTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCACG
GACGTAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACGGG
AGACGACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAAGC
ACGCGATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACGTG
CGATGGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGACAC
GTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGGAC
ACTACGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCGGT
GACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATGGA
GGAGAGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTCCA
CCGTGGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGGCA
AACGGGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAGCA
GTTCGAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGACG
TCAGGAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGGTC
AAGGAGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGATCT
TCAGACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCAAG
ACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGACC
GGAGACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCCTC
TGACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCTGT
ACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCAAG
AAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGTCT
GGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAACC
TATTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCGCG
ATCCTGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACACAC
GGATGACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGCCA
CTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACGAC
CTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACCGC
ACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGACA
ACGACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCGCC
ACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCGCA
CAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTGGA
CAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGGTG
GGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCTGA
CGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAACA
AACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGAAG
TTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCCAT
CCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACATCG
ACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATCGC
CCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGTAC
CCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTCCA
TTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGGGT
CTGGACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGACAA
GACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCGCG
CGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACGGC
GACCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCACTG
CGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAAAA
TATCTGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTTCC
CATGACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACCGG
CACTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGTCA
GCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCTAC
GAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAACG
CATCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGGGG
TGTGGCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGGCC
GCGGACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAGCT
ATTCAACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGTGG
GGCACAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCTAC
CTGGTGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGGAA
GTCGTCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGACG
TCGACACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTGTC
GAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACGGG
CAAGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGGGC
AAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAGCG
GAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGACGG
AGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGTCG
GGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGGAC
ACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTCTC
AGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCGAA
GTGGTGACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAGAC
GAAGATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCCGA
CATCGAACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGATG
ATGTCACCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGGAC
AGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGATA
CCGTGCGCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGAGA
TCGTGTACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACCAT
CTGCAGCGCTTCTACCTCAAACACACGGATGACATCATCTCTATGGTCAA
ACACCCGCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCCGG
CTATCCACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGCAG
GGCCAGCATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGCGA
GCTGCTGGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTGGG
ATTGGAAAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATCTG
CTGTTTGAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACGGT
CGGCAAGAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAAGT
CCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTTGC
GCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAATGG
AGACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGCGC
ACAACGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTGTG
GTGACCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTCGA
GCGGTTCCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGACT
CCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGCCC
GCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAGAT
CGACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGGCA
CGCACCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGCAC
CTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTGGC
GGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGCGC
GCACATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGAAC
GATGGAGGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCACC
TCAGTTCCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACCAG
ATGGGAAGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGTAC
AACGTGTACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGCTA
CATCACCCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAACT
CCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCGTC
AACATCCCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACTTC
CGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGTCA
CGGACGTAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGACG
GGAGACGACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGCAA
GCACGCGATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAACG
TGCGATGGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGGAC
ACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGACGG
ACACTACGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTCCG
GTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGATG
GAGGAGAGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCACCTC
CACCGTGGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCAGG
CAAACGGGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGGAG
CAGTTCGAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCTGA
CGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGAGG
TCAAGGAGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTGAT
CTTCAGACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGACCA
AGACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGAGA
CCGGAGACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGGCC
TCTGACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATGCT
GTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCACCA
AGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACAGT
CTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAATAA
CCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGTCG
CGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAACAC
ACGGATGACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTCGC
CACTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAACG
ACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCACC
GCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTCGA
CAACGACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCTCG
CCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACCCG
CACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTCTG
GACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAAGG
TGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAGCT
GACGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGGAA
CAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCATGA
AGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGTCC
ATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAACAT
CGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGATC
GCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCGGT
ACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTCTC
CATTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTGGG
GTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGGAC
AAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACGCG
CGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGACG
GCGACCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTCAC
TGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAGAA
AATATCTGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGGTT
CCCATGACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGACC
GGCACTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGATGT
CAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTTCT
ACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGGAA
CGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAGGG
GGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCTGG
CCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCAAG
CTATTCAACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTACGT
GGGGCACAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACACCT
ACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGAGG
AAGTCGTCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCGGA
CGTCGACACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGTTG
TCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACACG
GGCAAGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGCGG
GCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCACAG
CGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGGAC
GGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGGGT
CGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGTGG
ACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGTTC
TCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGTCG
AAGTGGTGACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGAAG
ACGAAGATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATTCC
GACATCGAACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGCGA
TGATGTCACCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGTGG
ACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATGGA
TACCGTGCGCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGAGA
GATCGTGTACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAACC
ATCTGCAGCGCTTCTACCTCAAACACACGGATGACATCATCTCTATGGTC
AAACACCCGCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGACCC
GGCTATCCACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCTGC
AGGGCCAGCATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACGGC
GAGCTGCTGGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTGTG
GGATTGGAAAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGATC
TGCTGTTTGAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGACG
GTCGGCAAGAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTCAA
GTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCTTT
GCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCAAT
GGAGACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAAGC
GCACAACGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGTTG
TGGTGACCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACTTC
GAGCGGTTCCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGCGA
CTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCTGC
CCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGGAG
ATCGACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACGGG
CACGCACCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAAGC
ACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACCTG
GCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGTGC
GCGCACATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCATGA
ACGATGGAGGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGTCA
CCTCAGTTCCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCACC
AGATGGGAAGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGTGT
ACAACGTGTACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCAGC
TACATCACCCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACCAA
CTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCGCG
TCAACATCCCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGACT
TCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGACGT
CACGGACGTAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGCGA
CGGGAGACGACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGGGC
AAGCACGCGATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCGAA
CGTGCGATGGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTATGG
ACACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATGAC
GGACACTACGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGACTC
CGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGAGA
TGGAGGAGAGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCACC
TCCACCGTGGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCGCA
GGCAAACGGGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAAGG
AGCAGTTCGAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGGCT
GACGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCAGA
GGTCAAGGAGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGTTG
ATCTTCAGACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGGAC
CAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCAGA
GACCGGAGACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGAGG
CCTCTGACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGATG
CTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGCAC
CAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGACA
GTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGAAT
AACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCAGT
CGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAAAC
ACACGGATGACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCTTC
GCCACTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGGAA
CGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGTCA
CCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGCTC
GACAACGACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCTCT
CGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAACC
CGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACTTC
TGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGCAA
GGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGAAG
CTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCGGG
AACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACCAT
GAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGGGT
CCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACAAC
ATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGACGA
TCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGCCG
GTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCTTC
TCCATTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTCTG
GGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGAGG
ACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGACG
CGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCTGA
CGGCGACCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTTTC
ACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGGAG
AAAATATCTGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTCGG
TTCCCATGACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCGGA
CCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGGAT
GTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTGTT
CTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCTGG
AACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGCAG
GGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGCCT
GGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGTCA
AGCTATTCAACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGTAC
GTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGACAC
CTACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCAGA
GGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACTCG
GACGTCGACACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTGGT
TGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAACA
CGGGCAAGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCGGC
GGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTCAC
AGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGTGG
ACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCAGG
GTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTCGT
GGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCATGT
TCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACAGT
CGAAGTGGTGACGTTTGAGGTGCAGAGACCGGAGACGCCTTTGATACTGA
AGACGAAGATGCCAGCGACTCGGAGGCCTCTGACGAGGAGGACTGCGATT
CCGACATCGAACGCGAGGGGGAGATGCTGTACAGGCGGCTGGCGTGCCGC
GATGATGTCACCGATATGAAGCGCACCAAGAAGAGAAAAACCAAAACTGT
GGACAGAAAAGCGCCCCCTGCCGACAGTCTGGAGCTCGTCTTCGTGCATG
GATACCGTGCGCACGACTGCAGGAATAACCTATTCTGCACGAGTCGCGGA
GAGATCGTGTACCACGTGGCAGCAGTCGCGATCCTGTACGACAAGACCAA
CCATCTGCAGCGCTTCTACCTCAAACACACGGATGACATCATCTCTATGG
TCAAACACCCGCAGAAAGACGTCTTCGCCACTGGACAGGTCGGTAAGGAC
CCGGCTATCCACGTGTGGGACGGGAACGACCTCAGCACGCTCATCAGTCT
GCAGGGCCAGCATCAGCGCGGCGTCACCGCACTCGACTTCTCAGGAGACG
GCGAGCTGCTGGCTAGCGTGGGGCTCGACAACGACCACACCATCGTGCTG
TGGGATTGGAAAAACGGCACCCCTCTCGCCACGACAAGGGGCAGCAAGGA
TCTGCTGTTTGAGATCAAGTTCAACCCGCACAACCCCGATAAGCTGGTGA
CGGTCGGCAAGAAGCACATCAACTTCTGGACAAGATCAGGAAACACCTTC
AAGTCCAAGCGAGGTATCTTCGGCAAGGTGGGGAAGATGACCACCATGCT
TTGCGCGGAGTTCGGTCGCTCGGAAGCTGACGTGTTCAGCGGGGGAGCCA
ATGGAGACATCTACGTCTGGAGCGGGAACAAACTCCTTAAGGAGGTCGAA
GCGCACAACGGACCTCTTAACACCATGAAGTTCATCCCGCAGAAGGGTGT
TGTGGTGACCGGCGGGAAGGACGGGTCCATCCTGCAGTGGAACGACAACT
TCGAGCGGTTCCTGAAGAAGTACAACATCGACCGGTTCTCGGAGACGCGC
GACTCCCGCGGGGTGCTGCTGGACGATCGCCCGGCGGTCCGCGCGGTCCT
GCCCGCCGAGGGGCGCATCCTGGCCGGTACCCGGAGCGGCGAGGTGCTGG
AGATCGACCTGAGCAACGGGCTCTTCTCCATTCTGGTGCAGGGCCACACG
GGCACGCACCTTGAGAACGAGGTCTGGGGTCTGGACACGCACCCTAAGAA
GCACCTGTGCGTGACGGTGAGCGAGGACAAGACGCTGCGCGTGTGGGACC
TGGCGGCGGACCAGAACCAGCTGACGCGCGCGCGGAAGCTGCGGACAGGT
GCGCGCACATGCGCCTTCTCACCTGACGGCGACCTGATCGCGGTGGGCAT
GAACGATGGAGGGTTCGTGATCTTTCACTGCGGGAACCTTGAAGCGGCGT
CACCTCAGTTCCGCCACCGGAAGGAGAAAATATCTGACCTCAAGTTTTCA
CCAGATGGGAAGTACATCGCTGTCGGTTCCCATGACAACTTTGTTGACGT
GTACAACGTGTACAAGATGAAGCGGACCGGCACTTGCAGGGGGTCCTCCA
GCTACATCACCCACTTGGACTGGGATGTCAGCGGCCGTCTGCTACAGACC
AACTCCGGCGCGAAGGAGCGGCTGTTCTACGAGGTCCCGCGGTGCAAGCG
CGTCAACATCCCCAGCTCCGAGCTGGAACGCATCACGTGGTCCACCTGGA
CTTCCGTTCTGGGACCGGAAGTGCAGGGGGTGTGGCCGTGGTACAGTGAC
GTCACGGACGTAAACGCCACCTGCCTGGCCGCGGACAAGACGCTGTTGGC
GACGGGAGACGACAACGGATTCGTCAAGCTATTCAACTACCCTGCAACGG
GCAAGCACGCGATCTGTAAGAAGTACGTGGGGCACAGCAGTCACGTGGCG
AACGTGCGATGGACGTATGACGACACCTACCTGGTGTCAGCAGGAGGTAT
GGACACGTCCATCATGGTGTGGCAGAGGAAGTCGTCCCAGCCGCGGGATG
ACGGACACTACGACAGCGAGGACTCGGACGTCGACACGGACGACGAAGAC
TCCGGTGACGGTGCGGGCGGCGTGGTTGTCGAGGAGCGCGTTGCGCACGA
GATGGAGGAGAGTTACGACCCGAACACGGGCAAGACCACCTACATCCGCA
CCTCCACCGTGGAGACCACCATCGGCGGGCAAGACGGCCAGGACAGTCCG
CAGGCAAACGGGCACGGCAGGCTCACAGCGGAACAAGTACAAGAGTTTAA
GGAGCAGTTCGAGATGACGGACGTGGACGGAGACGGGCTGATAAACCTGG
CTGACGTCAGGAAGATCCTGGTCAGGGTCGGGTACCGACCTTCACCCGCA
GAGGTCAAGGAGATGATGCGGGTCGTGGACACCAGCGCTGAAAAGAAGGT
TGATCTTCAGACATGCCTTAGCATGTTCTCAGGCCCCAAGAAGGACAAGG
ACCAAGACGAAGTGAAGAGGGACAGTCGAAGTGGTGACGTTTGAGGTGCA
GAGACCGGAGACGCCTTTGATACTGAAGACGAAGATGCCAGCGACTCGGA
GGCCTCTGACGAGGAGGACTGCGATTCCGACATCGAACGCGAGGGGGAGA
TGCTGTACAGGCGGCTGGCGTGCCGCGATGATGTCACCGATATGAAGCGC
ACCAAGAAGAGAAAAACCAAAACTGTGGACAGAAAAGCGCCCCCTGCCGA
CAGTCTGGAGCTCGTCTTCGTGCATGGATACCGTGCGCACGACTGCAGGA
ATAACCTATTCTGCACGAGTCGCGGAGAGATCGTGTACCACGTGGCAGCA
GTCGCGATCCTGTACGACAAGACCAACCATCTGCAGCGCTTCTACCTCAA
ACACACGGATGACATCATCTCTATGGTCAAACACCCGCAGAAAGACGTCT
TCGCCACTGGACAGGTCGGTAAGGACCCGGCTATCCACGTGTGGGACGGG
AACGACCTCAGCACGCTCATCAGTCTGCAGGGCCAGCATCAGCGCGGCGT
CACCGCACTCGACTTCTCAGGAGACGGCGAGCTGCTGGCTAGCGTGGGGC
TCGACAACGACCACACCATCGTGCTGTGGGATTGGAAAAACGGCACCCCT
CTCGCCACGACAAGGGGCAGCAAGGATCTGCTGTTTGAGATCAAGTTCAA
CCCGCACAACCCCGATAAGCTGGTGACGGTCGGCAAGAAGCACATCAACT
TCTGGACAAGATCAGGAAACACCTTCAAGTCCAAGCGAGGTATCTTCGGC
AAGGTGGGGAAGATGACCACCATGCTTTGCGCGGAGTTCGGTCGCTCGGA
AGCTGACGTGTTCAGCGGGGGAGCCAATGGAGACATCTACGTCTGGAGCG
GGAACAAACTCCTTAAGGAGGTCGAAGCGCACAACGGACCTCTTAACACC
ATGAAGTTCATCCCGCAGAAGGGTGTTGTGGTGACCGGCGGGAAGGACGG
GTCCATCCTGCAGTGGAACGACAACTTCGAGCGGTTCCTGAAGAAGTACA
ACATCGACCGGTTCTCGGAGACGCGCGACTCCCGCGGGGTGCTGCTGGAC
GATCGCCCGGCGGTCCGCGCGGTCCTGCCCGCCGAGGGGCGCATCCTGGC
CGGTACCCGGAGCGGCGAGGTGCTGGAGATCGACCTGAGCAACGGGCTCT
TCTCCATTCTGGTGCAGGGCCACACGGGCACGCACCTTGAGAACGAGGTC
TGGGGTCTGGACACGCACCCTAAGAAGCACCTGTGCGTGACGGTGAGCGA
GGACAAGACGCTGCGCGTGTGGGACCTGGCGGCGGACCAGAACCAGCTGA
CGCGCGCGCGGAAGCTGCGGACAGGTGCGCGCACATGCGCCTTCTCACCT
GACGGCGACCTGATCGCGGTGGGCATGAACGATGGAGGGTTCGTGATCTT
TCACTGCGGGAACCTTGAAGCGGCGTCACCTCAGTTCCGCCACCGGAAGG
AGAAAATATCTGACCTCAAGTTTTCACCAGATGGGAAGTACATCGCTGTC
GGTTCCCATGACAACTTTGTTGACGTGTACAACGTGTACAAGATGAAGCG
GACCGGCACTTGCAGGGGGTCCTCCAGCTACATCACCCACTTGGACTGGG
ATGTCAGCGGCCGTCTGCTACAGACCAACTCCGGCGCGAAGGAGCGGCTG
TTCTACGAGGTCCCGCGGTGCAAGCGCGTCAACATCCCCAGCTCCGAGCT
GGAACGCATCACGTGGTCCACCTGGACTTCCGTTCTGGGACCGGAAGTGC
AGGGGGTGTGGCCGTGGTACAGTGACGTCACGGACGTAAACGCCACCTGC
CTGGCCGCGGACAAGACGCTGTTGGCGACGGGAGACGACAACGGATTCGT
CAAGCTATTCAACTACCCTGCAACGGGCAAGCACGCGATCTGTAAGAAGT
ACGTGGGGCACAGCAGTCACGTGGCGAACGTGCGATGGACGTATGACGAC
ACCTACCTGGTGTCAGCAGGAGGTATGGACACGTCCATCATGGTGTGGCA
GAGGAAGTCGTCCCAGCCGCGGGATGACGGACACTACGACAGCGAGGACT
CGGACGTCGACACGGACGACGAAGACTCCGGTGACGGTGCGGGCGGCGTG
GTTGTCGAGGAGCGCGTTGCGCACGAGATGGAGGAGAGTTACGACCCGAA
CACGGGCAAGACCACCTACATCCGCACCTCCACCGTGGAGACCACCATCG
GCGGGCAAGACGGCCAGGACAGTCCGCAGGCAAACGGGCACGGCAGGCTC
ACAGCGGAACAAGTACAAGAGTTTAAGGAGCAGTTCGAGATGACGGACGT
GGACGGAGACGGGCTGATAAACCTGGCTGACGTCAGGAAGATCCTGGTCA
GGGTCGGGTACCGACCTTCACCCGCAGAGGTCAAGGAGATGATGCGGGTC
GTGGACACCAGCGCTGAAAAGAAGGTTGATCTTCAGACATGCCTTAGCAT
GTTCTCAGGCCCCAAGAAGGACAAGGACCAAGACGAAGTGAAGAGGGACA
GTCGAAGTGGTGACGTTTGA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97472gene:BL97472Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97472_cuf11transcript:BL97472_cuf11-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97472_cuf11-E1BL97472_cuf11-E1-1564476830-102461Branchiostoma lanceolatumexon
BL97472_cuf11-E2BL97472_cuf11-E2-1564476830-102463Branchiostoma lanceolatumexon
BL97472_cuf11-E3BL97472_cuf11-E3-1564476830-102465Branchiostoma lanceolatumexon
BL97472_cuf11-E4BL97472_cuf11-E4-1564476830-102467Branchiostoma lanceolatumexon
BL97472_cuf11-E5BL97472_cuf11-E5-1564476830-102469Branchiostoma lanceolatumexon
BL97472_cuf11-E6BL97472_cuf11-E6-1564476830-102471Branchiostoma lanceolatumexon
BL97472_cuf11-E7BL97472_cuf11-E7-1564476830-102473Branchiostoma lanceolatumexon
BL97472_cuf11-E8BL97472_cuf11-E8-1564476830-102475Branchiostoma lanceolatumexon
BL97472_cuf11-E9BL97472_cuf11-E9-1564476830-102477Branchiostoma lanceolatumexon
BL97472_cuf11-E10BL97472_cuf11-E10-1564476830-102479Branchiostoma lanceolatumexon
BL97472_cuf11-E11BL97472_cuf11-E11-1564476830-102481Branchiostoma lanceolatumexon
BL97472_cuf11-E12BL97472_cuf11-E12-1564476830-102483Branchiostoma lanceolatumexon
BL97472_cuf11-E13BL97472_cuf11-E13-1564476830-102485Branchiostoma lanceolatumexon
BL97472_cuf11-E14BL97472_cuf11-E14-1564476830-102487Branchiostoma lanceolatumexon
BL97472_cuf11-E15BL97472_cuf11-E15-1564476830-102489Branchiostoma lanceolatumexon
BL97472_cuf11-E16BL97472_cuf11-E16-1564476830-102491Branchiostoma lanceolatumexon
BL97472_cuf11-E17BL97472_cuf11-E17-1564476830-102493Branchiostoma lanceolatumexon
BL97472_cuf11-E18BL97472_cuf11-E18-1564476830-102495Branchiostoma lanceolatumexon
BL97472_cuf11-E19BL97472_cuf11-E19-1564476830-102497Branchiostoma lanceolatumexon
BL97472_cuf11-E20BL97472_cuf11-E20-1564476830-102500Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000011genomeSc0000011:1657399..1671775 +
Properties
Property NameValue
Transcript idBL97472_cuf11
Biotypeprotein_coding