Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97432_cuf0 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97432_cuf0
Unique Nametranscript:BL97432_cuf0
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97432_cuf0

>transcript:BL97432_cuf0-protein ID=transcript:BL97432_cuf0-protein|Name=transcript:BL97432_cuf0|organism=Branchiostoma lanceolatum|type=polypeptide|length=875bp
DARPEIVSLGCWRDKADRAIPTMEGSDARLDGSYPARQDAINKCRKLTEA
RGFNTFALQNGGWCASSATAAQTYRKYGPSTSCATDGEGGPWGNQVYQIT
GPSACEAPLDLFLLLDGSGSVGTANFDKVKQFAADVVNSFDVSPTATRIG
VAQYSDRNSLVFNLGDKADKPSTVSAINGVAYQSGGTKTGAALQHVRDNA
AWRGGDVPKVVIVLTDGKSGDDVAAAAQSLAADGVKVYAIGVGNFDHGEL
IQIANNDQNNVIELNNFDALATKIDEIAKVVCSYVSDACPSGYNGHGGIC
YKAFNAKKTFLQAAKACYADGGTLAMPRDAATNDFIKSLKDAIDPSGFFW
FGLVDQHKENEWVWIDGRPLGSFSDWKPGEPNNLGDEDFAEYFPTQWNDV
GGNAKNRRFICQVIPIDCPEGYVYHQPSRTCYKAFDAKKSYDGAVEACSA
DGGSLAMPRDDATNVFLIYLKNAVDNRGWFRFGLTDEHQEGGWMWSDGIA
LGSYEPWGPGEPNNLRNEDCGEYFPGSRPKKTRNKWNDGPCPNKNRKFIC
QFIPKGCPKGYKQSGASCYKAFDTDKNYDEAAKVCRNEGGSLAMPRDKVT
NDFLINLKNKVDSTSWFWLGADDKNDEGTWRYXDDKNDEGIWRYIDGEPF
GSFSDWSPGEPNQAGGNEDCLVLFESPRDNWNDQGCATKQKFICQIHLPI
HDSCGGNVPGEFGVIVSPGYPVTQTEHRKCSWNFMARPGKVVTLIFEDFD
LESTLDTVTVEDPCSDTELGKFSGTTLPPPVHSSDKQARVVLTIGTTDRS
VPGRGFRFKFIATPSSAKRGVDEPLSAQQPDETLQGRGQEEADRNTNQEM
LMETLKILEEDLRNAGNELEYNHEE
Run BLAST on NCBI

mRNA from alignment at Sc0000061:1094885..1101819-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97432_cuf0 ID=transcript:BL97432_cuf0|Name=transcript:BL97432_cuf0|organism=Branchiostoma lanceolatum|type=mRNA|length=6935bp|location=Sequence derived from alignment at Sc0000061:1094885..1101819- (Branchiostoma lanceolatum)
CAGATGCCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAAGGCA GACAGAGCCATCCCAACCATGGAGGGGTCGGACGCGCGTCTGGACGGGAG TTATCCGGCTCGTCAGGACGCGATCAACAAGTGCCGCAAGCTGACCGAGG CTCGAGGTTTCAACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGCTTCT TCAGCCACCGCTGCTCAAACCTACAGGAAGTACGGACCGTCCACAAGCTG CGCTACGGACGGCGAGGGCGGGCCATGGGGGAACCAGGTCTACCAAATCA CAGGTTTGTGTATCTTTACTGATGAAGGAAACTGTCCACGAATCTGTCCT CGACCGGAGTAGTTCAATTTGTTGATGTTTTTTGCCTTAATTATATACCG TTTGCTATCTAAATGGATGATAGCATGCGCAATTTGTACGTCCAACCAAC CAACCAACCAACCAACCAACCAACCAACCAACCAACCAACCAACCAACCA ACCCAACCCAACCCAAACCAACCCAACCATCAAAACTTACTATTGCTTTA GAGGAAGACAATTGATGAATGTAGATTCAATGAATTCTTCAATCATATAG ACGGATATATGGATGTCACTTATGCCTAACATTTCTCCTTGTAAAACTCT ACTAGGACCGTCAGCATGTGAGGCGCCACTGGATTTATTCCTACTTCTGG ATGGATCTGGCAGCGTAGGGACTGCAAACTTCGATAAGGTGAAACAGTTT GCTGCCGATGTGGTCAACAGCTTCGACGTAAGCCCGACTGCCACCAGGAT TGGTGTAGCACAGTACTCTGACAGGAACTCGTGAGTGTCTGGCCTTTTAT ATCTATTATTATATCTATCTATATCTATTATGTCTAGGGCCTTGGACCAT GGACTATAGNAGGGCCCTGGACCATGGACTATAGGGCCCTGAACCGTGTA ACATAGATTAACCTATTCTTTCGGAGGGGAGTAAGTGGCCAGTTCCTGGC AGGTAGGCAGATTATGTGTATCAATCTGGCAGTGACAGTCTCTAAACCAT TCATTTCTCAGCCTGGTGTTTAACCTGGGAGACAAGGCCGACAAGCCGTC CACCGTGAGCGCCATTAATGGTGTCGCGTACCAGAGCGGCGGCACGAAGA CCGGGGCTGCTCTACAACACGTCCGTGATAACGCAGCATGGAGGGGCGGC GATGTCCCGAAGGTACGTACCGAAATGTAAAGATATTTGATATAGTGTAT AGATACAGTTGTTGCTGTTGTTGTTGTTGTTCACCTTGTAGTGCCTGGTG CACATAGGTTAGCAAGTTTCCTTGCTGTTCCAGTAGTAAGGTATATTTTG CAGGGAGGGGTTGCTAGCCCTTCCCTTTAACGGGCGTCAAAAAAGCTCTT GGGACCACTATTTTACGTCCGTTCCTGATCACGACAGTCACACGGGCGTA TCTACTTACTCCCACAGGTGGTGATCGTGTTGACAGACGGAAAGTCCGGT GATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGT GTACGCCATCGGAGTGGGAAACTTCGATCATGGGGAGCTCATTCAAATTG CCAACAACGATCAAAACAACGTAATCGAGTTGAACAACTTTGATGCCCTG GCCACGAAGATTGACGAGATTGCCAAAGTTGTCTGCTCATATGTGTCAGA CGGTATGTTTCGATTTAATACTTACAGGGTTAGCTGTTATACATCTAAAT ATAGTAAAGTAAAGCCAGTAAAGTAAAGTAAAGCCAGTAAAGTAAAGTAA AGTAAAGTAAAGTAAAGTAAAGTAAAGTAAAGTAAAGTAAAGTAAAGTAA AGTAAAGAAAAATGAATAATAAAAAGATAAACACAGCAAAATACATTTTT CAGCTTGCCCTAGTGGCTACAATGGCCATGGTGGGATCTGCTACAAGGCA TTCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGA TGGCGGCACCCTCGCCATGCCCCGGGATGCCGCCACCAACGACTTCATCA AGTCCCTGAAGGACGCCATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTG GTGGATCAGCACAAGGAGAACGAGTGGGTTTGGATAGACGGCCGGCCCCT CGGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAAACAATCTTGGCGACG AGGATTTTGCCGAGTACTTCCCTACACAGTGGAACGACGTGGGCGGCAAC GCAAAGAACAGGAGATTCATCTGCCAAGTGATTCCAATCGGTACGTCATC AAAATGCCTGTAACGTTTAAGGCACATTTTCAGTTCAAATGACTACGAGT TTGCATTTAGAACAGGTTATTAATAACGTTACAGTTACGCTTTACAGTGC GTTTAAAACGACGAGTACGTTGGTAGCCCGTCTAACTTTCCCCCATATTC TATTGATGCAGATTGCCCAGAAGGCTACGTGTACCATCAGCCAAGTCGCA CGTGCTACAAAGCCTTCGACGCCAAGAAAAGCTACGACGGAGCAGTTGAA GCCTGTTCTGCAGACGGCGGTTCCCTCGCCATGCCCCGTGATGACGCCAC CAACGTGTTCCTCATCTACCTGAAGAATGCTGTCGACAACAGAGGCTGGT TCCGCTTCGGGCTGACCGATGAGCACCAGGAAGGGGGGTGGATGTGGTCG GACGGCATCGCCCTGGGGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAA TAACCTGAGAAACGAGGACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTA AGAAAACAAGAAACAAGTGGAATGACGGGCCATGTCCCAATAAAAACAGG AAGTTTATCTGCCAATTTATCCCGAAAGGTACGTTTGACAACAGTAGTTT CTATTGTTTAGATTACAAATCAACACGAGCCAATACCTTTAAATGAGTTT CCTGCATTTGACGGAGAATCCCTATAATGTGCACGACTACTTTCTTTCAT CGTCTTCTGTAGGATGTCCCAAAGGGTACAAGCAGAGCGGTGCTAGCTGC TACAAGGCCTTCGACACTGACAAGAATTACGACGAAGCTGCGAAGGTTTG TCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAGGTTACTAACG ACTTCTTGATCAACCTGAAGAACAAAGTGGACAGCACTTCGTGGTTCTGG CTCGGAGCGGATGACAAGAATGACGAGGGTACATGGCGGTACANGGATGA CAAGAATGACGAGGGTATATGGCGGTACATCGACGGTGAACCCTTCGGGA GCTTCAGCGACTGGTCCCCGGGCGAACCGAACCAAGCCGGCGGGAACGAG GACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGAACGACCAAGG CTGCGCAACAAAGCAGAAATTCATCTGCCAGATCCATCTGCCAAGTAAGT TTACCATTTGAATTGACAGGGATTGGGCTATTCATGGCATTTCGGAACAG ATATCACACGAGACACAAACGAAGATATAAGTTTTAGACTGTACTAATGT CTTTCCAACAGACCATGTAACATAACATGCTTAGTATCTATTCTACTATT AAGCTTTAGGGCATTCTAAAGATTTGTCTTTTTGTAGTCTTGCAGCTGTA AGACTGACAAATGACTTTGAAATGCCATTTTGTTTCTAATATGCTCGTTA AATCTTTCATTCCAGTCCATGACTCCTGTGGTGGCAATGTTCCCGGAGAG TTCGGAGTGATTGTCTCACCGGGCTATCCGGTGACACAAACAGAGCATCG GAAATGCAGGCATGTTACTTGTTATTTTTTATTATCATGCCAGAGAAACC TTAACTAGACACCGTTCTAGATCTGTTCTTTTAAAGAGGTTTTACTTATG AATTAAAAATGAAGTGATTTGAATGTCATCTTGCAGCTGGAACTTCATGG CTCGACCAGGGAAGGTTGTGACCCTGATCTTCGAGGATTTCGACCTGGAG AGTACCCTCGACACGGTGACCGTTGAAGACCCCTGCAGCGACACGGAGCT GGGGAAGTTCTCTGGGACCACTCTTCCTCCACCTGTCCACAGCAGCGACA AACAGGCCAGGGTCGTCCTCACCATCGGCACCACCGACCGCTCTGTCCCT GGACGTGGTTTCAGGTTCAAATTCATCGGTATGTTAGAAGATCTTCCCAA AACGTTACCGGGCGAACTCATAGTTTGTGGTTACAAACTACCTACCTAGT CCCTACTACCTACTAACGTAATATGACCAATTAACGTCCGATTTATTCAA AACGTATTTATCTTAAAACCGCGCGGACAGAGCCAAATTTCAAACCCATG GGCAGAAATATCAGCTCTTCTAAAAAGAAAATGGATGGTATGTAAGTTTT TCTCCGCCTGTTTAAAGCCGTGCGAGCATGTATTTATACTGAGGTATATG ATGAAGAATTGTGCTAGGGTAACCCATTATCGTCCACTTCTGAATCTTTT CCCTTCTAGCGCTATGCTTGAAGAACATAGACCAGAAAAAAAATGCACAG TAACTGTCCAAAGTAGTCTGCAGACAAATGAAAATAATATCATAATATAA TGTCTGTCCGGCCACTTGCTTAACGCGATGGAAAAAAAACAATGTTTATC TGTAACTTTCCCCCACACGCGCGGCACGTGGCGTTCACGTGGTAAACGCA TGGCCATTATATTTTGCTGTGCAAAAATTAAAGAGATGGCTAAGGATCAT ACTTATGATGTTCTTTATTGCTCATGAGAACAGGCTTTGGCATAATACAC CGCGACATGTGGACATGAGCCAAACCGGACGTAAATAGGTTCTGCACGTA AATAGGTCATGTTACGTTANACCGCGACATGTGGACATGAGCCAAACCGG ACGTAAATAGGTTCTGCGCGTAAATAGGTCATGTTACGTTACCTACTACC TGCCTAGTCCCCACTACCTCCCTACCTGCTATCTACCTACCTACCTACCT ACCTACTTACCTAATCAAAGTTCAATATTACTGAACTTTGGTTAAATCAA TATAACCTCATATCAATATTGTATACAATATCAAAGTTCAATAACCAATA TTATCTCATACTCTTTATCAAAGTTCAATAACCAATATTATCTCTTTATC AAAGTTCAATAACCAATATTATCTCTGTTCTCTACAGCCACACCCTCTTC TGCTAAACGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGCCCGATGAGA CCCTGCAGGGGCGTGGCCAGGAGGAGGCTGACAGAAACACCAACCAGGAG ATGCTGATGGAGACCCTGAAGATACTGGAGGAGGACCTGCGTAATGCTGG CAACGAGCTAGAGGTACGATTGACAGATCTACATCAAACAGAATATCTAG CCTCTACCAGGCTCCATCGGTCGCTGAAAACATGTCAGAGGAGTTAGCCG AGAACTTGGGTCGCAAACTGTACTTCCAGACCGGCTAAATCCCCTGGCGA TGTTTTCTGTACATGTCTATTTGGCCAACCTCTACTATGTTACGGTGACC TACGGAGCCTGGTAGAGGCTATCAATACCTATCAATTCAGCAAATTGGAT TGCTAAAGTTGAAAGATTGATTCATCTTTTGTACTACTCAACCGGGATAT CGATATCAGAAGGAGCGTTTCCATTTTAATCGATTTTACCCTTTCGCAAG TTAAGAAATTCATTGTAGGATATTGCGCCTTTCCGCGTTGGCGCGCAGTG AACTCATTCAAAATATTTGACAGGGTAAAAAAACAACTTTATCAACAATT ATTTTCCTACAGACCCCTGTGTGGCAGATCTTTAAGTTACTGTATGTACA TATCCACACTAACCCGTTTGCATTATATGCAACCTTAATGTTCTATATGT GGTCTAAGCTTGTATTAACTCAAACCACTTGTTTCTCCTTCTGTAGTATA ATCATGAAGAGTGACAGCAAGTGACGACAACTGGACCACAAAGGCAAAAC CAATCATCAGAATACAGGAACACAGGACAATATAACTGCTTAGCAAGATG CTTCAGTAGGGCAAAGACAACATCAGAAATGATAAAGAATAGTAATCATG GAAATCAAGAGTGTTCATCTGGTATTTTCTTTGTACTTGTAACGTTAATA CTATGGCTGAAAACATCAACGTAATTAACAAGTGCAAATGTCAATCATCT TTCTTTTATCTTCCAGGAGCAATATCAAATTATTTTTACTTTTGTCTATT TCCGGGGTAATTGTGCAATGAAATAAGAACTTTTGTAGGCCTGTTTCTTT ATTTCTGTTACTAGTAAACTTCTGATTTGACGGTTATGTTGATACTTCCC CCACAGCGCTATACGCAAAATGTATGACATACCACCAAGAGTATTCTTCA ACTTTGTAACAACACAGTTAACAGCAACATTCTGGAGGTAAACTTTGCCA AATACCACATAGTGTATGTAAACACTGCACCAATTTGATGAGGCGTTACA GCAAATCCTGGGCTTATATATGGAGGGGTCATGGTTCTGAAACCAATATC ACTATTATTTCGTTGAAATATATCCACCTACTAGGTAACCGGAGACTGTC AACCAACTTGCTTCTCCAGAGTTTTCCTACTGTTAAACTCAATTGCTTAA GTTTAAGGAATTTTAATGTCAAAATATAGTAAACGTAGGTAGATACCAAC CTGTTTGGTAATACGTTATGATGTACAAACGCTTGCACCAACAATTCTAC TTCATAGACAAAATCGAACTGAGAATCTCTTACCTGTTACAACACAACAA AGTACATTTTACTTCACTGACGAGGAAAAACACTGGATTCTGATTCTTGA TACTTATACGGAACTAGATGTTTACTGAAAGGAAATTATTGTCACATATT CAAGATTGCCATTAAAGCTGCCATTGCAAGTACGT

Coding sequence (CDS) from alignment at Sc0000061:1094885..1101819-

>transcript:BL97432_cuf0 ID=transcript:BL97432_cuf0|Name=transcript:BL97432_cuf0|organism=Branchiostoma lanceolatum|type=CDS|length=28908bp|location=Sequence derived from alignment at Sc0000061:1094885..1101819- (Branchiostoma lanceolatum)
GATGCCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAAGGCAGA
CAGAGCCATCCCAACCATGGAGGGGTCGGACGCGCGTCTGGACGGGAGTT
ATCCGGCTCGTCAGGACGCGATCAACAAGTGCCGCAAGCTGACCGAGGCT
CGAGGTTTCAACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGCTTCTTC
AGCCACCGCTGCTCAAACCTACAGGAAGTACGGACCGTCCACAAGCTGCG
CTACGGACGGCGAGGGCGGGCCATGGGGGAACCAGGTCTACCAAATCACA
GGACCGTCAGCATGTGAGGCGCCACTGGATTTATTCCTACTTCTGGATGG
ATCTGGCAGCGTAGGGACTGCAAACTTCGATAAGGTGAAACAGTTTGCTG
CCGATGTGGTCAACAGCTTCGACGTAAGCCCGACTGCCACCAGGATTGGT
GTAGCACAGTACTCTGACAGGAACTCCCTGGTGTTTAACCTGGGAGACAA
GGCCGACAAGCCGTCCACCGTGAGCGCCATTAATGGTGTCGCGTACCAGA
GCGGCGGCACGAAGACCGGGGCTGCTCTACAACACGTCCGTGATAACGCA
GCATGGAGGGGCGGCGATGTCCCGAAGGTGGTGATCGTGTTGACAGACGG
AAAGTCCGGTGATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGACG
GAGTGAAAGTGTACGCCATCGGAGTGGGAAACTTCGATCATGGGGAGCTC
ATTCAAATTGCCAACAACGATCAAAACAACGTAATCGAGTTGAACAACTT
TGATGCCCTGGCCACGAAGATTGACGAGATTGCCAAAGTTGTCTGCTCAT
ATGTGTCAGACGCTTGCCCTAGTGGCTACAATGGCCATGGTGGGATCTGC
TACAAGGCATTCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAAGGCTTG
TTACGCGGATGGCGGCACCCTCGCCATGCCCCGGGATGCCGCCACCAACG
ACTTCATCAAGTCCCTGAAGGACGCCATAGACCCGTCCGGTTTCTTCTGG
TTCGGTCTGGTGGATCAGCACAAGGAGAACGAGTGGGTTTGGATAGACGG
CCGGCCCCTCGGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAAACAATC
TTGGCGACGAGGATTTTGCCGAGTACTTCCCTACACAGTGGAACGACGTG
GGCGGCAACGCAAAGAACAGGAGATTCATCTGCCAAGTGATTCCAATCGA
TTGCCCAGAAGGCTACGTGTACCATCAGCCAAGTCGCACGTGCTACAAAG
CCTTCGACGCCAAGAAAAGCTACGACGGAGCAGTTGAAGCCTGTTCTGCA
GACGGCGGTTCCCTCGCCATGCCCCGTGATGACGCCACCAACGTGTTCCT
CATCTACCTGAAGAATGCTGTCGACAACAGAGGCTGGTTCCGCTTCGGGC
TGACCGATGAGCACCAGGAAGGGGGGTGGATGTGGTCGGACGGCATCGCC
CTGGGGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAATAACCTGAGAAA
CGAGGACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTAAGAAAACAAGAA
ACAAGTGGAATGACGGGCCATGTCCCAATAAAAACAGGAAGTTTATCTGC
CAATTTATCCCGAAAGGATGTCCCAAAGGGTACAAGCAGAGCGGTGCTAG
CTGCTACAAGGCCTTCGACACTGACAAGAATTACGACGAAGCTGCGAAGG
TTTGTCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAGGTTACT
AACGACTTCTTGATCAACCTGAAGAACAAAGTGGACAGCACTTCGTGGTT
CTGGCTCGGAGCGGATGACAAGAATGACGAGGGTACATGGCGGTACANGG
ATGACAAGAATGACGAGGGTATATGGCGGTACATCGACGGTGAACCCTTC
GGGAGCTTCAGCGACTGGTCCCCGGGCGAACCGAACCAAGCCGGCGGGAA
CGAGGACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGAACGACC
AAGGCTGCGCAACAAAGCAGAAATTCATCTGCCAGATCCATCTGCCAATC
CATGACTCCTGTGGTGGCAATGTTCCCGGAGAGTTCGGAGTGATTGTCTC
ACCGGGCTATCCGGTGACACAAACAGAGCATCGGAAATGCAGCTGGAACT
TCATGGCTCGACCAGGGAAGGTTGTGACCCTGATCTTCGAGGATTTCGAC
CTGGAGAGTACCCTCGACACGGTGACCGTTGAAGACCCCTGCAGCGACAC
GGAGCTGGGGAAGTTCTCTGGGACCACTCTTCCTCCACCTGTCCACAGCA
GCGACAAACAGGCCAGGGTCGTCCTCACCATCGGCACCACCGACCGCTCT
GTCCCTGGACGTGGTTTCAGGTTCAAATTCATCGCCACACCCTCTTCTGC
TAAACGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGCCCGATGAGACCC
TGCAGGGGCGTGGCCAGGAGGAGGCTGACAGAAACACCAACCAGGAGATG
CTGATGGAGACCCTGAAGATACTGGAGGAGGACCTGCGTAATGCTGGCAA
CGAGCTAGAGTATAATCATGAAGAGTGAGATGCCCGGCCGGAGATTGTAA
GCCTCGGCTGCTGGCGGGACAAGGCAGACAGAGCCATCCCAACCATGGAG
GGGTCGGACGCGCGTCTGGACGGGAGTTATCCGGCTCGTCAGGACGCGAT
CAACAAGTGCCGCAAGCTGACCGAGGCTCGAGGTTTCAACACCTTCGCGC
TGCAAAACGGAGGCTGGTGCGCTTCTTCAGCCACCGCTGCTCAAACCTAC
AGGAAGTACGGACCGTCCACAAGCTGCGCTACGGACGGCGAGGGCGGGCC
ATGGGGGAACCAGGTCTACCAAATCACAGGACCGTCAGCATGTGAGGCGC
CACTGGATTTATTCCTACTTCTGGATGGATCTGGCAGCGTAGGGACTGCA
AACTTCGATAAGGTGAAACAGTTTGCTGCCGATGTGGTCAACAGCTTCGA
CGTAAGCCCGACTGCCACCAGGATTGGTGTAGCACAGTACTCTGACAGGA
ACTCCCTGGTGTTTAACCTGGGAGACAAGGCCGACAAGCCGTCCACCGTG
AGCGCCATTAATGGTGTCGCGTACCAGAGCGGCGGCACGAAGACCGGGGC
TGCTCTACAACACGTCCGTGATAACGCAGCATGGAGGGGCGGCGATGTCC
CGAAGGTGGTGATCGTGTTGACAGACGGAAAGTCCGGTGATGACGTAGCG
GCGGCTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGTGTACGCCATCGG
AGTGGGAAACTTCGATCATGGGGAGCTCATTCAAATTGCCAACAACGATC
AAAACAACGTAATCGAGTTGAACAACTTTGATGCCCTGGCCACGAAGATT
GACGAGATTGCCAAAGTTGTCTGCTCATATGTGTCAGACGCTTGCCCTAG
TGGCTACAATGGCCATGGTGGGATCTGCTACAAGGCATTCAACGCGAAGA
AGACCTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGATGGCGGCACCCTC
GCCATGCCCCGGGATGCCGCCACCAACGACTTCATCAAGTCCCTGAAGGA
CGCCATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTGGTGGATCAGCACA
AGGAGAACGAGTGGGTTTGGATAGACGGCCGGCCCCTCGGCAGCTTCAGC
GACTGGAAACCGGGAGAGCCAAACAATCTTGGCGACGAGGATTTTGCCGA
GTACTTCCCTACACAGTGGAACGACGTGGGCGGCAACGCAAAGAACAGGA
GATTCATCTGCCAAGTGATTCCAATCGATTGCCCAGAAGGCTACGTGTAC
CATCAGCCAAGTCGCACGTGCTACAAAGCCTTCGACGCCAAGAAAAGCTA
CGACGGAGCAGTTGAAGCCTGTTCTGCAGACGGCGGTTCCCTCGCCATGC
CCCGTGATGACGCCACCAACGTGTTCCTCATCTACCTGAAGAATGCTGTC
GACAACAGAGGCTGGTTCCGCTTCGGGCTGACCGATGAGCACCAGGAAGG
GGGGTGGATGTGGTCGGACGGCATCGCCCTGGGGAGCTACGAGCCGTGGG
GTCCGGGAGAACCGAATAACCTGAGAAACGAGGACTGTGGCGAGTACTTC
CCTGGAAGTCGCCCTAAGAAAACAAGAAACAAGTGGAATGACGGGCCATG
TCCCAATAAAAACAGGAAGTTTATCTGCCAATTTATCCCGAAAGGATGTC
CCAAAGGGTACAAGCAGAGCGGTGCTAGCTGCTACAAGGCCTTCGACACT
GACAAGAATTACGACGAAGCTGCGAAGGTTTGTCGGAATGAAGGAGGGTC
TCTGGCCATGCCTCGTGACAAGGTTACTAACGACTTCTTGATCAACCTGA
AGAACAAAGTGGACAGCACTTCGTGGTTCTGGCTCGGAGCGGATGACAAG
AATGACGAGGGTACATGGCGGTACANGGATGACAAGAATGACGAGGGTAT
ATGGCGGTACATCGACGGTGAACCCTTCGGGAGCTTCAGCGACTGGTCCC
CGGGCGAACCGAACCAAGCCGGCGGGAACGAGGACTGCCTGGTGCTGTTC
GAAAGCCCCAGGGACAACTGGAACGACCAAGGCTGCGCAACAAAGCAGAA
ATTCATCTGCCAGATCCATCTGCCAATCCATGACTCCTGTGGTGGCAATG
TTCCCGGAGAGTTCGGAGTGATTGTCTCACCGGGCTATCCGGTGACACAA
ACAGAGCATCGGAAATGCAGCTGGAACTTCATGGCTCGACCAGGGAAGGT
TGTGACCCTGATCTTCGAGGATTTCGACCTGGAGAGTACCCTCGACACGG
TGACCGTTGAAGACCCCTGCAGCGACACGGAGCTGGGGAAGTTCTCTGGG
ACCACTCTTCCTCCACCTGTCCACAGCAGCGACAAACAGGCCAGGGTCGT
CCTCACCATCGGCACCACCGACCGCTCTGTCCCTGGACGTGGTTTCAGGT
TCAAATTCATCGCCACACCCTCTTCTGCTAAACGAGGGGTTGACGAACCG
CTGTCTGCCCAGCAGCCCGATGAGACCCTGCAGGGGCGTGGCCAGGAGGA
GGCTGACAGAAACACCAACCAGGAGATGCTGATGGAGACCCTGAAGATAC
TGGAGGAGGACCTGCGTAATGCTGGCAACGAGCTAGAGTATAATCATGAA
GAGTGAGATGCCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAA
GGCAGACAGAGCCATCCCAACCATGGAGGGGTCGGACGCGCGTCTGGACG
GGAGTTATCCGGCTCGTCAGGACGCGATCAACAAGTGCCGCAAGCTGACC
GAGGCTCGAGGTTTCAACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGC
TTCTTCAGCCACCGCTGCTCAAACCTACAGGAAGTACGGACCGTCCACAA
GCTGCGCTACGGACGGCGAGGGCGGGCCATGGGGGAACCAGGTCTACCAA
ATCACAGGACCGTCAGCATGTGAGGCGCCACTGGATTTATTCCTACTTCT
GGATGGATCTGGCAGCGTAGGGACTGCAAACTTCGATAAGGTGAAACAGT
TTGCTGCCGATGTGGTCAACAGCTTCGACGTAAGCCCGACTGCCACCAGG
ATTGGTGTAGCACAGTACTCTGACAGGAACTCCCTGGTGTTTAACCTGGG
AGACAAGGCCGACAAGCCGTCCACCGTGAGCGCCATTAATGGTGTCGCGT
ACCAGAGCGGCGGCACGAAGACCGGGGCTGCTCTACAACACGTCCGTGAT
AACGCAGCATGGAGGGGCGGCGATGTCCCGAAGGTGGTGATCGTGTTGAC
AGACGGAAAGTCCGGTGATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCG
CCGACGGAGTGAAAGTGTACGCCATCGGAGTGGGAAACTTCGATCATGGG
GAGCTCATTCAAATTGCCAACAACGATCAAAACAACGTAATCGAGTTGAA
CAACTTTGATGCCCTGGCCACGAAGATTGACGAGATTGCCAAAGTTGTCT
GCTCATATGTGTCAGACGCTTGCCCTAGTGGCTACAATGGCCATGGTGGG
ATCTGCTACAAGGCATTCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAA
GGCTTGTTACGCGGATGGCGGCACCCTCGCCATGCCCCGGGATGCCGCCA
CCAACGACTTCATCAAGTCCCTGAAGGACGCCATAGACCCGTCCGGTTTC
TTCTGGTTCGGTCTGGTGGATCAGCACAAGGAGAACGAGTGGGTTTGGAT
AGACGGCCGGCCCCTCGGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAA
ACAATCTTGGCGACGAGGATTTTGCCGAGTACTTCCCTACACAGTGGAAC
GACGTGGGCGGCAACGCAAAGAACAGGAGATTCATCTGCCAAGTGATTCC
AATCGATTGCCCAGAAGGCTACGTGTACCATCAGCCAAGTCGCACGTGCT
ACAAAGCCTTCGACGCCAAGAAAAGCTACGACGGAGCAGTTGAAGCCTGT
TCTGCAGACGGCGGTTCCCTCGCCATGCCCCGTGATGACGCCACCAACGT
GTTCCTCATCTACCTGAAGAATGCTGTCGACAACAGAGGCTGGTTCCGCT
TCGGGCTGACCGATGAGCACCAGGAAGGGGGGTGGATGTGGTCGGACGGC
ATCGCCCTGGGGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAATAACCT
GAGAAACGAGGACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTAAGAAAA
CAAGAAACAAGTGGAATGACGGGCCATGTCCCAATAAAAACAGGAAGTTT
ATCTGCCAATTTATCCCGAAAGGATGTCCCAAAGGGTACAAGCAGAGCGG
TGCTAGCTGCTACAAGGCCTTCGACACTGACAAGAATTACGACGAAGCTG
CGAAGGTTTGTCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAG
GTTACTAACGACTTCTTGATCAACCTGAAGAACAAAGTGGACAGCACTTC
GTGGTTCTGGCTCGGAGCGGATGACAAGAATGACGAGGGTACATGGCGGT
ACANGGATGACAAGAATGACGAGGGTATATGGCGGTACATCGACGGTGAA
CCCTTCGGGAGCTTCAGCGACTGGTCCCCGGGCGAACCGAACCAAGCCGG
CGGGAACGAGGACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGA
ACGACCAAGGCTGCGCAACAAAGCAGAAATTCATCTGCCAGATCCATCTG
CCAATCCATGACTCCTGTGGTGGCAATGTTCCCGGAGAGTTCGGAGTGAT
TGTCTCACCGGGCTATCCGGTGACACAAACAGAGCATCGGAAATGCAGCT
GGAACTTCATGGCTCGACCAGGGAAGGTTGTGACCCTGATCTTCGAGGAT
TTCGACCTGGAGAGTACCCTCGACACGGTGACCGTTGAAGACCCCTGCAG
CGACACGGAGCTGGGGAAGTTCTCTGGGACCACTCTTCCTCCACCTGTCC
ACAGCAGCGACAAACAGGCCAGGGTCGTCCTCACCATCGGCACCACCGAC
CGCTCTGTCCCTGGACGTGGTTTCAGGTTCAAATTCATCGCCACACCCTC
TTCTGCTAAACGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGCCCGATG
AGACCCTGCAGGGGCGTGGCCAGGAGGAGGCTGACAGAAACACCAACCAG
GAGATGCTGATGGAGACCCTGAAGATACTGGAGGAGGACCTGCGTAATGC
TGGCAACGAGCTAGAGTATAATCATGAAGAGTGAGATGCCCGGCCGGAGA
TTGTAAGCCTCGGCTGCTGGCGGGACAAGGCAGACAGAGCCATCCCAACC
ATGGAGGGGTCGGACGCGCGTCTGGACGGGAGTTATCCGGCTCGTCAGGA
CGCGATCAACAAGTGCCGCAAGCTGACCGAGGCTCGAGGTTTCAACACCT
TCGCGCTGCAAAACGGAGGCTGGTGCGCTTCTTCAGCCACCGCTGCTCAA
ACCTACAGGAAGTACGGACCGTCCACAAGCTGCGCTACGGACGGCGAGGG
CGGGCCATGGGGGAACCAGGTCTACCAAATCACAGGACCGTCAGCATGTG
AGGCGCCACTGGATTTATTCCTACTTCTGGATGGATCTGGCAGCGTAGGG
ACTGCAAACTTCGATAAGGTGAAACAGTTTGCTGCCGATGTGGTCAACAG
CTTCGACGTAAGCCCGACTGCCACCAGGATTGGTGTAGCACAGTACTCTG
ACAGGAACTCCCTGGTGTTTAACCTGGGAGACAAGGCCGACAAGCCGTCC
ACCGTGAGCGCCATTAATGGTGTCGCGTACCAGAGCGGCGGCACGAAGAC
CGGGGCTGCTCTACAACACGTCCGTGATAACGCAGCATGGAGGGGCGGCG
ATGTCCCGAAGGTGGTGATCGTGTTGACAGACGGAAAGTCCGGTGATGAC
GTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGTGTACGC
CATCGGAGTGGGAAACTTCGATCATGGGGAGCTCATTCAAATTGCCAACA
ACGATCAAAACAACGTAATCGAGTTGAACAACTTTGATGCCCTGGCCACG
AAGATTGACGAGATTGCCAAAGTTGTCTGCTCATATGTGTCAGACGCTTG
CCCTAGTGGCTACAATGGCCATGGTGGGATCTGCTACAAGGCATTCAACG
CGAAGAAGACCTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGATGGCGGC
ACCCTCGCCATGCCCCGGGATGCCGCCACCAACGACTTCATCAAGTCCCT
GAAGGACGCCATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTGGTGGATC
AGCACAAGGAGAACGAGTGGGTTTGGATAGACGGCCGGCCCCTCGGCAGC
TTCAGCGACTGGAAACCGGGAGAGCCAAACAATCTTGGCGACGAGGATTT
TGCCGAGTACTTCCCTACACAGTGGAACGACGTGGGCGGCAACGCAAAGA
ACAGGAGATTCATCTGCCAAGTGATTCCAATCGATTGCCCAGAAGGCTAC
GTGTACCATCAGCCAAGTCGCACGTGCTACAAAGCCTTCGACGCCAAGAA
AAGCTACGACGGAGCAGTTGAAGCCTGTTCTGCAGACGGCGGTTCCCTCG
CCATGCCCCGTGATGACGCCACCAACGTGTTCCTCATCTACCTGAAGAAT
GCTGTCGACAACAGAGGCTGGTTCCGCTTCGGGCTGACCGATGAGCACCA
GGAAGGGGGGTGGATGTGGTCGGACGGCATCGCCCTGGGGAGCTACGAGC
CGTGGGGTCCGGGAGAACCGAATAACCTGAGAAACGAGGACTGTGGCGAG
TACTTCCCTGGAAGTCGCCCTAAGAAAACAAGAAACAAGTGGAATGACGG
GCCATGTCCCAATAAAAACAGGAAGTTTATCTGCCAATTTATCCCGAAAG
GATGTCCCAAAGGGTACAAGCAGAGCGGTGCTAGCTGCTACAAGGCCTTC
GACACTGACAAGAATTACGACGAAGCTGCGAAGGTTTGTCGGAATGAAGG
AGGGTCTCTGGCCATGCCTCGTGACAAGGTTACTAACGACTTCTTGATCA
ACCTGAAGAACAAAGTGGACAGCACTTCGTGGTTCTGGCTCGGAGCGGAT
GACAAGAATGACGAGGGTACATGGCGGTACANGGATGACAAGAATGACGA
GGGTATATGGCGGTACATCGACGGTGAACCCTTCGGGAGCTTCAGCGACT
GGTCCCCGGGCGAACCGAACCAAGCCGGCGGGAACGAGGACTGCCTGGTG
CTGTTCGAAAGCCCCAGGGACAACTGGAACGACCAAGGCTGCGCAACAAA
GCAGAAATTCATCTGCCAGATCCATCTGCCAATCCATGACTCCTGTGGTG
GCAATGTTCCCGGAGAGTTCGGAGTGATTGTCTCACCGGGCTATCCGGTG
ACACAAACAGAGCATCGGAAATGCAGCTGGAACTTCATGGCTCGACCAGG
GAAGGTTGTGACCCTGATCTTCGAGGATTTCGACCTGGAGAGTACCCTCG
ACACGGTGACCGTTGAAGACCCCTGCAGCGACACGGAGCTGGGGAAGTTC
TCTGGGACCACTCTTCCTCCACCTGTCCACAGCAGCGACAAACAGGCCAG
GGTCGTCCTCACCATCGGCACCACCGACCGCTCTGTCCCTGGACGTGGTT
TCAGGTTCAAATTCATCGCCACACCCTCTTCTGCTAAACGAGGGGTTGAC
GAACCGCTGTCTGCCCAGCAGCCCGATGAGACCCTGCAGGGGCGTGGCCA
GGAGGAGGCTGACAGAAACACCAACCAGGAGATGCTGATGGAGACCCTGA
AGATACTGGAGGAGGACCTGCGTAATGCTGGCAACGAGCTAGAGTATAAT
CATGAAGAGTGAGATGCCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCG
GGACAAGGCAGACAGAGCCATCCCAACCATGGAGGGGTCGGACGCGCGTC
TGGACGGGAGTTATCCGGCTCGTCAGGACGCGATCAACAAGTGCCGCAAG
CTGACCGAGGCTCGAGGTTTCAACACCTTCGCGCTGCAAAACGGAGGCTG
GTGCGCTTCTTCAGCCACCGCTGCTCAAACCTACAGGAAGTACGGACCGT
CCACAAGCTGCGCTACGGACGGCGAGGGCGGGCCATGGGGGAACCAGGTC
TACCAAATCACAGGACCGTCAGCATGTGAGGCGCCACTGGATTTATTCCT
ACTTCTGGATGGATCTGGCAGCGTAGGGACTGCAAACTTCGATAAGGTGA
AACAGTTTGCTGCCGATGTGGTCAACAGCTTCGACGTAAGCCCGACTGCC
ACCAGGATTGGTGTAGCACAGTACTCTGACAGGAACTCCCTGGTGTTTAA
CCTGGGAGACAAGGCCGACAAGCCGTCCACCGTGAGCGCCATTAATGGTG
TCGCGTACCAGAGCGGCGGCACGAAGACCGGGGCTGCTCTACAACACGTC
CGTGATAACGCAGCATGGAGGGGCGGCGATGTCCCGAAGGTGGTGATCGT
GTTGACAGACGGAAAGTCCGGTGATGACGTAGCGGCGGCTGCTCAGAGCC
TGGCCGCCGACGGAGTGAAAGTGTACGCCATCGGAGTGGGAAACTTCGAT
CATGGGGAGCTCATTCAAATTGCCAACAACGATCAAAACAACGTAATCGA
GTTGAACAACTTTGATGCCCTGGCCACGAAGATTGACGAGATTGCCAAAG
TTGTCTGCTCATATGTGTCAGACGCTTGCCCTAGTGGCTACAATGGCCAT
GGTGGGATCTGCTACAAGGCATTCAACGCGAAGAAGACCTTCCTCCAGGC
GGCTAAGGCTTGTTACGCGGATGGCGGCACCCTCGCCATGCCCCGGGATG
CCGCCACCAACGACTTCATCAAGTCCCTGAAGGACGCCATAGACCCGTCC
GGTTTCTTCTGGTTCGGTCTGGTGGATCAGCACAAGGAGAACGAGTGGGT
TTGGATAGACGGCCGGCCCCTCGGCAGCTTCAGCGACTGGAAACCGGGAG
AGCCAAACAATCTTGGCGACGAGGATTTTGCCGAGTACTTCCCTACACAG
TGGAACGACGTGGGCGGCAACGCAAAGAACAGGAGATTCATCTGCCAAGT
GATTCCAATCGATTGCCCAGAAGGCTACGTGTACCATCAGCCAAGTCGCA
CGTGCTACAAAGCCTTCGACGCCAAGAAAAGCTACGACGGAGCAGTTGAA
GCCTGTTCTGCAGACGGCGGTTCCCTCGCCATGCCCCGTGATGACGCCAC
CAACGTGTTCCTCATCTACCTGAAGAATGCTGTCGACAACAGAGGCTGGT
TCCGCTTCGGGCTGACCGATGAGCACCAGGAAGGGGGGTGGATGTGGTCG
GACGGCATCGCCCTGGGGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAA
TAACCTGAGAAACGAGGACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTA
AGAAAACAAGAAACAAGTGGAATGACGGGCCATGTCCCAATAAAAACAGG
AAGTTTATCTGCCAATTTATCCCGAAAGGATGTCCCAAAGGGTACAAGCA
GAGCGGTGCTAGCTGCTACAAGGCCTTCGACACTGACAAGAATTACGACG
AAGCTGCGAAGGTTTGTCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGT
GACAAGGTTACTAACGACTTCTTGATCAACCTGAAGAACAAAGTGGACAG
CACTTCGTGGTTCTGGCTCGGAGCGGATGACAAGAATGACGAGGGTACAT
GGCGGTACANGGATGACAAGAATGACGAGGGTATATGGCGGTACATCGAC
GGTGAACCCTTCGGGAGCTTCAGCGACTGGTCCCCGGGCGAACCGAACCA
AGCCGGCGGGAACGAGGACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACA
ACTGGAACGACCAAGGCTGCGCAACAAAGCAGAAATTCATCTGCCAGATC
CATCTGCCAATCCATGACTCCTGTGGTGGCAATGTTCCCGGAGAGTTCGG
AGTGATTGTCTCACCGGGCTATCCGGTGACACAAACAGAGCATCGGAAAT
GCAGCTGGAACTTCATGGCTCGACCAGGGAAGGTTGTGACCCTGATCTTC
GAGGATTTCGACCTGGAGAGTACCCTCGACACGGTGACCGTTGAAGACCC
CTGCAGCGACACGGAGCTGGGGAAGTTCTCTGGGACCACTCTTCCTCCAC
CTGTCCACAGCAGCGACAAACAGGCCAGGGTCGTCCTCACCATCGGCACC
ACCGACCGCTCTGTCCCTGGACGTGGTTTCAGGTTCAAATTCATCGCCAC
ACCCTCTTCTGCTAAACGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGC
CCGATGAGACCCTGCAGGGGCGTGGCCAGGAGGAGGCTGACAGAAACACC
AACCAGGAGATGCTGATGGAGACCCTGAAGATACTGGAGGAGGACCTGCG
TAATGCTGGCAACGAGCTAGAGTATAATCATGAAGAGTGAGATGCCCGGC
CGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAAGGCAGACAGAGCCATC
CCAACCATGGAGGGGTCGGACGCGCGTCTGGACGGGAGTTATCCGGCTCG
TCAGGACGCGATCAACAAGTGCCGCAAGCTGACCGAGGCTCGAGGTTTCA
ACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGCTTCTTCAGCCACCGCT
GCTCAAACCTACAGGAAGTACGGACCGTCCACAAGCTGCGCTACGGACGG
CGAGGGCGGGCCATGGGGGAACCAGGTCTACCAAATCACAGGACCGTCAG
CATGTGAGGCGCCACTGGATTTATTCCTACTTCTGGATGGATCTGGCAGC
GTAGGGACTGCAAACTTCGATAAGGTGAAACAGTTTGCTGCCGATGTGGT
CAACAGCTTCGACGTAAGCCCGACTGCCACCAGGATTGGTGTAGCACAGT
ACTCTGACAGGAACTCCCTGGTGTTTAACCTGGGAGACAAGGCCGACAAG
CCGTCCACCGTGAGCGCCATTAATGGTGTCGCGTACCAGAGCGGCGGCAC
GAAGACCGGGGCTGCTCTACAACACGTCCGTGATAACGCAGCATGGAGGG
GCGGCGATGTCCCGAAGGTGGTGATCGTGTTGACAGACGGAAAGTCCGGT
GATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGT
GTACGCCATCGGAGTGGGAAACTTCGATCATGGGGAGCTCATTCAAATTG
CCAACAACGATCAAAACAACGTAATCGAGTTGAACAACTTTGATGCCCTG
GCCACGAAGATTGACGAGATTGCCAAAGTTGTCTGCTCATATGTGTCAGA
CGCTTGCCCTAGTGGCTACAATGGCCATGGTGGGATCTGCTACAAGGCAT
TCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGAT
GGCGGCACCCTCGCCATGCCCCGGGATGCCGCCACCAACGACTTCATCAA
GTCCCTGAAGGACGCCATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTGG
TGGATCAGCACAAGGAGAACGAGTGGGTTTGGATAGACGGCCGGCCCCTC
GGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAAACAATCTTGGCGACGA
GGATTTTGCCGAGTACTTCCCTACACAGTGGAACGACGTGGGCGGCAACG
CAAAGAACAGGAGATTCATCTGCCAAGTGATTCCAATCGATTGCCCAGAA
GGCTACGTGTACCATCAGCCAAGTCGCACGTGCTACAAAGCCTTCGACGC
CAAGAAAAGCTACGACGGAGCAGTTGAAGCCTGTTCTGCAGACGGCGGTT
CCCTCGCCATGCCCCGTGATGACGCCACCAACGTGTTCCTCATCTACCTG
AAGAATGCTGTCGACAACAGAGGCTGGTTCCGCTTCGGGCTGACCGATGA
GCACCAGGAAGGGGGGTGGATGTGGTCGGACGGCATCGCCCTGGGGAGCT
ACGAGCCGTGGGGTCCGGGAGAACCGAATAACCTGAGAAACGAGGACTGT
GGCGAGTACTTCCCTGGAAGTCGCCCTAAGAAAACAAGAAACAAGTGGAA
TGACGGGCCATGTCCCAATAAAAACAGGAAGTTTATCTGCCAATTTATCC
CGAAAGGATGTCCCAAAGGGTACAAGCAGAGCGGTGCTAGCTGCTACAAG
GCCTTCGACACTGACAAGAATTACGACGAAGCTGCGAAGGTTTGTCGGAA
TGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAGGTTACTAACGACTTCT
TGATCAACCTGAAGAACAAAGTGGACAGCACTTCGTGGTTCTGGCTCGGA
GCGGATGACAAGAATGACGAGGGTACATGGCGGTACANGGATGACAAGAA
TGACGAGGGTATATGGCGGTACATCGACGGTGAACCCTTCGGGAGCTTCA
GCGACTGGTCCCCGGGCGAACCGAACCAAGCCGGCGGGAACGAGGACTGC
CTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGAACGACCAAGGCTGCGC
AACAAAGCAGAAATTCATCTGCCAGATCCATCTGCCAATCCATGACTCCT
GTGGTGGCAATGTTCCCGGAGAGTTCGGAGTGATTGTCTCACCGGGCTAT
CCGGTGACACAAACAGAGCATCGGAAATGCAGCTGGAACTTCATGGCTCG
ACCAGGGAAGGTTGTGACCCTGATCTTCGAGGATTTCGACCTGGAGAGTA
CCCTCGACACGGTGACCGTTGAAGACCCCTGCAGCGACACGGAGCTGGGG
AAGTTCTCTGGGACCACTCTTCCTCCACCTGTCCACAGCAGCGACAAACA
GGCCAGGGTCGTCCTCACCATCGGCACCACCGACCGCTCTGTCCCTGGAC
GTGGTTTCAGGTTCAAATTCATCGCCACACCCTCTTCTGCTAAACGAGGG
GTTGACGAACCGCTGTCTGCCCAGCAGCCCGATGAGACCCTGCAGGGGCG
TGGCCAGGAGGAGGCTGACAGAAACACCAACCAGGAGATGCTGATGGAGA
CCCTGAAGATACTGGAGGAGGACCTGCGTAATGCTGGCAACGAGCTAGAG
TATAATCATGAAGAGTGAGATGCCCGGCCGGAGATTGTAAGCCTCGGCTG
CTGGCGGGACAAGGCAGACAGAGCCATCCCAACCATGGAGGGGTCGGACG
CGCGTCTGGACGGGAGTTATCCGGCTCGTCAGGACGCGATCAACAAGTGC
CGCAAGCTGACCGAGGCTCGAGGTTTCAACACCTTCGCGCTGCAAAACGG
AGGCTGGTGCGCTTCTTCAGCCACCGCTGCTCAAACCTACAGGAAGTACG
GACCGTCCACAAGCTGCGCTACGGACGGCGAGGGCGGGCCATGGGGGAAC
CAGGTCTACCAAATCACAGGACCGTCAGCATGTGAGGCGCCACTGGATTT
ATTCCTACTTCTGGATGGATCTGGCAGCGTAGGGACTGCAAACTTCGATA
AGGTGAAACAGTTTGCTGCCGATGTGGTCAACAGCTTCGACGTAAGCCCG
ACTGCCACCAGGATTGGTGTAGCACAGTACTCTGACAGGAACTCCCTGGT
GTTTAACCTGGGAGACAAGGCCGACAAGCCGTCCACCGTGAGCGCCATTA
ATGGTGTCGCGTACCAGAGCGGCGGCACGAAGACCGGGGCTGCTCTACAA
CACGTCCGTGATAACGCAGCATGGAGGGGCGGCGATGTCCCGAAGGTGGT
GATCGTGTTGACAGACGGAAAGTCCGGTGATGACGTAGCGGCGGCTGCTC
AGAGCCTGGCCGCCGACGGAGTGAAAGTGTACGCCATCGGAGTGGGAAAC
TTCGATCATGGGGAGCTCATTCAAATTGCCAACAACGATCAAAACAACGT
AATCGAGTTGAACAACTTTGATGCCCTGGCCACGAAGATTGACGAGATTG
CCAAAGTTGTCTGCTCATATGTGTCAGACGCTTGCCCTAGTGGCTACAAT
GGCCATGGTGGGATCTGCTACAAGGCATTCAACGCGAAGAAGACCTTCCT
CCAGGCGGCTAAGGCTTGTTACGCGGATGGCGGCACCCTCGCCATGCCCC
GGGATGCCGCCACCAACGACTTCATCAAGTCCCTGAAGGACGCCATAGAC
CCGTCCGGTTTCTTCTGGTTCGGTCTGGTGGATCAGCACAAGGAGAACGA
GTGGGTTTGGATAGACGGCCGGCCCCTCGGCAGCTTCAGCGACTGGAAAC
CGGGAGAGCCAAACAATCTTGGCGACGAGGATTTTGCCGAGTACTTCCCT
ACACAGTGGAACGACGTGGGCGGCAACGCAAAGAACAGGAGATTCATCTG
CCAAGTGATTCCAATCGATTGCCCAGAAGGCTACGTGTACCATCAGCCAA
GTCGCACGTGCTACAAAGCCTTCGACGCCAAGAAAAGCTACGACGGAGCA
GTTGAAGCCTGTTCTGCAGACGGCGGTTCCCTCGCCATGCCCCGTGATGA
CGCCACCAACGTGTTCCTCATCTACCTGAAGAATGCTGTCGACAACAGAG
GCTGGTTCCGCTTCGGGCTGACCGATGAGCACCAGGAAGGGGGGTGGATG
TGGTCGGACGGCATCGCCCTGGGGAGCTACGAGCCGTGGGGTCCGGGAGA
ACCGAATAACCTGAGAAACGAGGACTGTGGCGAGTACTTCCCTGGAAGTC
GCCCTAAGAAAACAAGAAACAAGTGGAATGACGGGCCATGTCCCAATAAA
AACAGGAAGTTTATCTGCCAATTTATCCCGAAAGGATGTCCCAAAGGGTA
CAAGCAGAGCGGTGCTAGCTGCTACAAGGCCTTCGACACTGACAAGAATT
ACGACGAAGCTGCGAAGGTTTGTCGGAATGAAGGAGGGTCTCTGGCCATG
CCTCGTGACAAGGTTACTAACGACTTCTTGATCAACCTGAAGAACAAAGT
GGACAGCACTTCGTGGTTCTGGCTCGGAGCGGATGACAAGAATGACGAGG
GTACATGGCGGTACANGGATGACAAGAATGACGAGGGTATATGGCGGTAC
ATCGACGGTGAACCCTTCGGGAGCTTCAGCGACTGGTCCCCGGGCGAACC
GAACCAAGCCGGCGGGAACGAGGACTGCCTGGTGCTGTTCGAAAGCCCCA
GGGACAACTGGAACGACCAAGGCTGCGCAACAAAGCAGAAATTCATCTGC
CAGATCCATCTGCCAATCCATGACTCCTGTGGTGGCAATGTTCCCGGAGA
GTTCGGAGTGATTGTCTCACCGGGCTATCCGGTGACACAAACAGAGCATC
GGAAATGCAGCTGGAACTTCATGGCTCGACCAGGGAAGGTTGTGACCCTG
ATCTTCGAGGATTTCGACCTGGAGAGTACCCTCGACACGGTGACCGTTGA
AGACCCCTGCAGCGACACGGAGCTGGGGAAGTTCTCTGGGACCACTCTTC
CTCCACCTGTCCACAGCAGCGACAAACAGGCCAGGGTCGTCCTCACCATC
GGCACCACCGACCGCTCTGTCCCTGGACGTGGTTTCAGGTTCAAATTCAT
CGCCACACCCTCTTCTGCTAAACGAGGGGTTGACGAACCGCTGTCTGCCC
AGCAGCCCGATGAGACCCTGCAGGGGCGTGGCCAGGAGGAGGCTGACAGA
AACACCAACCAGGAGATGCTGATGGAGACCCTGAAGATACTGGAGGAGGA
CCTGCGTAATGCTGGCAACGAGCTAGAGTATAATCATGAAGAGTGAGATG
CCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAAGGCAGACAGA
GCCATCCCAACCATGGAGGGGTCGGACGCGCGTCTGGACGGGAGTTATCC
GGCTCGTCAGGACGCGATCAACAAGTGCCGCAAGCTGACCGAGGCTCGAG
GTTTCAACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGCTTCTTCAGCC
ACCGCTGCTCAAACCTACAGGAAGTACGGACCGTCCACAAGCTGCGCTAC
GGACGGCGAGGGCGGGCCATGGGGGAACCAGGTCTACCAAATCACAGGAC
CGTCAGCATGTGAGGCGCCACTGGATTTATTCCTACTTCTGGATGGATCT
GGCAGCGTAGGGACTGCAAACTTCGATAAGGTGAAACAGTTTGCTGCCGA
TGTGGTCAACAGCTTCGACGTAAGCCCGACTGCCACCAGGATTGGTGTAG
CACAGTACTCTGACAGGAACTCCCTGGTGTTTAACCTGGGAGACAAGGCC
GACAAGCCGTCCACCGTGAGCGCCATTAATGGTGTCGCGTACCAGAGCGG
CGGCACGAAGACCGGGGCTGCTCTACAACACGTCCGTGATAACGCAGCAT
GGAGGGGCGGCGATGTCCCGAAGGTGGTGATCGTGTTGACAGACGGAAAG
TCCGGTGATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGACGGAGT
GAAAGTGTACGCCATCGGAGTGGGAAACTTCGATCATGGGGAGCTCATTC
AAATTGCCAACAACGATCAAAACAACGTAATCGAGTTGAACAACTTTGAT
GCCCTGGCCACGAAGATTGACGAGATTGCCAAAGTTGTCTGCTCATATGT
GTCAGACGCTTGCCCTAGTGGCTACAATGGCCATGGTGGGATCTGCTACA
AGGCATTCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAAGGCTTGTTAC
GCGGATGGCGGCACCCTCGCCATGCCCCGGGATGCCGCCACCAACGACTT
CATCAAGTCCCTGAAGGACGCCATAGACCCGTCCGGTTTCTTCTGGTTCG
GTCTGGTGGATCAGCACAAGGAGAACGAGTGGGTTTGGATAGACGGCCGG
CCCCTCGGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAAACAATCTTGG
CGACGAGGATTTTGCCGAGTACTTCCCTACACAGTGGAACGACGTGGGCG
GCAACGCAAAGAACAGGAGATTCATCTGCCAAGTGATTCCAATCGATTGC
CCAGAAGGCTACGTGTACCATCAGCCAAGTCGCACGTGCTACAAAGCCTT
CGACGCCAAGAAAAGCTACGACGGAGCAGTTGAAGCCTGTTCTGCAGACG
GCGGTTCCCTCGCCATGCCCCGTGATGACGCCACCAACGTGTTCCTCATC
TACCTGAAGAATGCTGTCGACAACAGAGGCTGGTTCCGCTTCGGGCTGAC
CGATGAGCACCAGGAAGGGGGGTGGATGTGGTCGGACGGCATCGCCCTGG
GGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAATAACCTGAGAAACGAG
GACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTAAGAAAACAAGAAACAA
GTGGAATGACGGGCCATGTCCCAATAAAAACAGGAAGTTTATCTGCCAAT
TTATCCCGAAAGGATGTCCCAAAGGGTACAAGCAGAGCGGTGCTAGCTGC
TACAAGGCCTTCGACACTGACAAGAATTACGACGAAGCTGCGAAGGTTTG
TCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAGGTTACTAACG
ACTTCTTGATCAACCTGAAGAACAAAGTGGACAGCACTTCGTGGTTCTGG
CTCGGAGCGGATGACAAGAATGACGAGGGTACATGGCGGTACANGGATGA
CAAGAATGACGAGGGTATATGGCGGTACATCGACGGTGAACCCTTCGGGA
GCTTCAGCGACTGGTCCCCGGGCGAACCGAACCAAGCCGGCGGGAACGAG
GACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGAACGACCAAGG
CTGCGCAACAAAGCAGAAATTCATCTGCCAGATCCATCTGCCAATCCATG
ACTCCTGTGGTGGCAATGTTCCCGGAGAGTTCGGAGTGATTGTCTCACCG
GGCTATCCGGTGACACAAACAGAGCATCGGAAATGCAGCTGGAACTTCAT
GGCTCGACCAGGGAAGGTTGTGACCCTGATCTTCGAGGATTTCGACCTGG
AGAGTACCCTCGACACGGTGACCGTTGAAGACCCCTGCAGCGACACGGAG
CTGGGGAAGTTCTCTGGGACCACTCTTCCTCCACCTGTCCACAGCAGCGA
CAAACAGGCCAGGGTCGTCCTCACCATCGGCACCACCGACCGCTCTGTCC
CTGGACGTGGTTTCAGGTTCAAATTCATCGCCACACCCTCTTCTGCTAAA
CGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGCCCGATGAGACCCTGCA
GGGGCGTGGCCAGGAGGAGGCTGACAGAAACACCAACCAGGAGATGCTGA
TGGAGACCCTGAAGATACTGGAGGAGGACCTGCGTAATGCTGGCAACGAG
CTAGAGTATAATCATGAAGAGTGAGATGCCCGGCCGGAGATTGTAAGCCT
CGGCTGCTGGCGGGACAAGGCAGACAGAGCCATCCCAACCATGGAGGGGT
CGGACGCGCGTCTGGACGGGAGTTATCCGGCTCGTCAGGACGCGATCAAC
AAGTGCCGCAAGCTGACCGAGGCTCGAGGTTTCAACACCTTCGCGCTGCA
AAACGGAGGCTGGTGCGCTTCTTCAGCCACCGCTGCTCAAACCTACAGGA
AGTACGGACCGTCCACAAGCTGCGCTACGGACGGCGAGGGCGGGCCATGG
GGGAACCAGGTCTACCAAATCACAGGACCGTCAGCATGTGAGGCGCCACT
GGATTTATTCCTACTTCTGGATGGATCTGGCAGCGTAGGGACTGCAAACT
TCGATAAGGTGAAACAGTTTGCTGCCGATGTGGTCAACAGCTTCGACGTA
AGCCCGACTGCCACCAGGATTGGTGTAGCACAGTACTCTGACAGGAACTC
CCTGGTGTTTAACCTGGGAGACAAGGCCGACAAGCCGTCCACCGTGAGCG
CCATTAATGGTGTCGCGTACCAGAGCGGCGGCACGAAGACCGGGGCTGCT
CTACAACACGTCCGTGATAACGCAGCATGGAGGGGCGGCGATGTCCCGAA
GGTGGTGATCGTGTTGACAGACGGAAAGTCCGGTGATGACGTAGCGGCGG
CTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGTGTACGCCATCGGAGTG
GGAAACTTCGATCATGGGGAGCTCATTCAAATTGCCAACAACGATCAAAA
CAACGTAATCGAGTTGAACAACTTTGATGCCCTGGCCACGAAGATTGACG
AGATTGCCAAAGTTGTCTGCTCATATGTGTCAGACGCTTGCCCTAGTGGC
TACAATGGCCATGGTGGGATCTGCTACAAGGCATTCAACGCGAAGAAGAC
CTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGATGGCGGCACCCTCGCCA
TGCCCCGGGATGCCGCCACCAACGACTTCATCAAGTCCCTGAAGGACGCC
ATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTGGTGGATCAGCACAAGGA
GAACGAGTGGGTTTGGATAGACGGCCGGCCCCTCGGCAGCTTCAGCGACT
GGAAACCGGGAGAGCCAAACAATCTTGGCGACGAGGATTTTGCCGAGTAC
TTCCCTACACAGTGGAACGACGTGGGCGGCAACGCAAAGAACAGGAGATT
CATCTGCCAAGTGATTCCAATCGATTGCCCAGAAGGCTACGTGTACCATC
AGCCAAGTCGCACGTGCTACAAAGCCTTCGACGCCAAGAAAAGCTACGAC
GGAGCAGTTGAAGCCTGTTCTGCAGACGGCGGTTCCCTCGCCATGCCCCG
TGATGACGCCACCAACGTGTTCCTCATCTACCTGAAGAATGCTGTCGACA
ACAGAGGCTGGTTCCGCTTCGGGCTGACCGATGAGCACCAGGAAGGGGGG
TGGATGTGGTCGGACGGCATCGCCCTGGGGAGCTACGAGCCGTGGGGTCC
GGGAGAACCGAATAACCTGAGAAACGAGGACTGTGGCGAGTACTTCCCTG
GAAGTCGCCCTAAGAAAACAAGAAACAAGTGGAATGACGGGCCATGTCCC
AATAAAAACAGGAAGTTTATCTGCCAATTTATCCCGAAAGGATGTCCCAA
AGGGTACAAGCAGAGCGGTGCTAGCTGCTACAAGGCCTTCGACACTGACA
AGAATTACGACGAAGCTGCGAAGGTTTGTCGGAATGAAGGAGGGTCTCTG
GCCATGCCTCGTGACAAGGTTACTAACGACTTCTTGATCAACCTGAAGAA
CAAAGTGGACAGCACTTCGTGGTTCTGGCTCGGAGCGGATGACAAGAATG
ACGAGGGTACATGGCGGTACANGGATGACAAGAATGACGAGGGTATATGG
CGGTACATCGACGGTGAACCCTTCGGGAGCTTCAGCGACTGGTCCCCGGG
CGAACCGAACCAAGCCGGCGGGAACGAGGACTGCCTGGTGCTGTTCGAAA
GCCCCAGGGACAACTGGAACGACCAAGGCTGCGCAACAAAGCAGAAATTC
ATCTGCCAGATCCATCTGCCAATCCATGACTCCTGTGGTGGCAATGTTCC
CGGAGAGTTCGGAGTGATTGTCTCACCGGGCTATCCGGTGACACAAACAG
AGCATCGGAAATGCAGCTGGAACTTCATGGCTCGACCAGGGAAGGTTGTG
ACCCTGATCTTCGAGGATTTCGACCTGGAGAGTACCCTCGACACGGTGAC
CGTTGAAGACCCCTGCAGCGACACGGAGCTGGGGAAGTTCTCTGGGACCA
CTCTTCCTCCACCTGTCCACAGCAGCGACAAACAGGCCAGGGTCGTCCTC
ACCATCGGCACCACCGACCGCTCTGTCCCTGGACGTGGTTTCAGGTTCAA
ATTCATCGCCACACCCTCTTCTGCTAAACGAGGGGTTGACGAACCGCTGT
CTGCCCAGCAGCCCGATGAGACCCTGCAGGGGCGTGGCCAGGAGGAGGCT
GACAGAAACACCAACCAGGAGATGCTGATGGAGACCCTGAAGATACTGGA
GGAGGACCTGCGTAATGCTGGCAACGAGCTAGAGTATAATCATGAAGAGT
GAGATGCCCGGCCGGAGATTGTAAGCCTCGGCTGCTGGCGGGACAAGGCA
GACAGAGCCATCCCAACCATGGAGGGGTCGGACGCGCGTCTGGACGGGAG
TTATCCGGCTCGTCAGGACGCGATCAACAAGTGCCGCAAGCTGACCGAGG
CTCGAGGTTTCAACACCTTCGCGCTGCAAAACGGAGGCTGGTGCGCTTCT
TCAGCCACCGCTGCTCAAACCTACAGGAAGTACGGACCGTCCACAAGCTG
CGCTACGGACGGCGAGGGCGGGCCATGGGGGAACCAGGTCTACCAAATCA
CAGGACCGTCAGCATGTGAGGCGCCACTGGATTTATTCCTACTTCTGGAT
GGATCTGGCAGCGTAGGGACTGCAAACTTCGATAAGGTGAAACAGTTTGC
TGCCGATGTGGTCAACAGCTTCGACGTAAGCCCGACTGCCACCAGGATTG
GTGTAGCACAGTACTCTGACAGGAACTCCCTGGTGTTTAACCTGGGAGAC
AAGGCCGACAAGCCGTCCACCGTGAGCGCCATTAATGGTGTCGCGTACCA
GAGCGGCGGCACGAAGACCGGGGCTGCTCTACAACACGTCCGTGATAACG
CAGCATGGAGGGGCGGCGATGTCCCGAAGGTGGTGATCGTGTTGACAGAC
GGAAAGTCCGGTGATGACGTAGCGGCGGCTGCTCAGAGCCTGGCCGCCGA
CGGAGTGAAAGTGTACGCCATCGGAGTGGGAAACTTCGATCATGGGGAGC
TCATTCAAATTGCCAACAACGATCAAAACAACGTAATCGAGTTGAACAAC
TTTGATGCCCTGGCCACGAAGATTGACGAGATTGCCAAAGTTGTCTGCTC
ATATGTGTCAGACGCTTGCCCTAGTGGCTACAATGGCCATGGTGGGATCT
GCTACAAGGCATTCAACGCGAAGAAGACCTTCCTCCAGGCGGCTAAGGCT
TGTTACGCGGATGGCGGCACCCTCGCCATGCCCCGGGATGCCGCCACCAA
CGACTTCATCAAGTCCCTGAAGGACGCCATAGACCCGTCCGGTTTCTTCT
GGTTCGGTCTGGTGGATCAGCACAAGGAGAACGAGTGGGTTTGGATAGAC
GGCCGGCCCCTCGGCAGCTTCAGCGACTGGAAACCGGGAGAGCCAAACAA
TCTTGGCGACGAGGATTTTGCCGAGTACTTCCCTACACAGTGGAACGACG
TGGGCGGCAACGCAAAGAACAGGAGATTCATCTGCCAAGTGATTCCAATC
GATTGCCCAGAAGGCTACGTGTACCATCAGCCAAGTCGCACGTGCTACAA
AGCCTTCGACGCCAAGAAAAGCTACGACGGAGCAGTTGAAGCCTGTTCTG
CAGACGGCGGTTCCCTCGCCATGCCCCGTGATGACGCCACCAACGTGTTC
CTCATCTACCTGAAGAATGCTGTCGACAACAGAGGCTGGTTCCGCTTCGG
GCTGACCGATGAGCACCAGGAAGGGGGGTGGATGTGGTCGGACGGCATCG
CCCTGGGGAGCTACGAGCCGTGGGGTCCGGGAGAACCGAATAACCTGAGA
AACGAGGACTGTGGCGAGTACTTCCCTGGAAGTCGCCCTAAGAAAACAAG
AAACAAGTGGAATGACGGGCCATGTCCCAATAAAAACAGGAAGTTTATCT
GCCAATTTATCCCGAAAGGATGTCCCAAAGGGTACAAGCAGAGCGGTGCT
AGCTGCTACAAGGCCTTCGACACTGACAAGAATTACGACGAAGCTGCGAA
GGTTTGTCGGAATGAAGGAGGGTCTCTGGCCATGCCTCGTGACAAGGTTA
CTAACGACTTCTTGATCAACCTGAAGAACAAAGTGGACAGCACTTCGTGG
TTCTGGCTCGGAGCGGATGACAAGAATGACGAGGGTACATGGCGGTACAN
GGATGACAAGAATGACGAGGGTATATGGCGGTACATCGACGGTGAACCCT
TCGGGAGCTTCAGCGACTGGTCCCCGGGCGAACCGAACCAAGCCGGCGGG
AACGAGGACTGCCTGGTGCTGTTCGAAAGCCCCAGGGACAACTGGAACGA
CCAAGGCTGCGCAACAAAGCAGAAATTCATCTGCCAGATCCATCTGCCAA
TCCATGACTCCTGTGGTGGCAATGTTCCCGGAGAGTTCGGAGTGATTGTC
TCACCGGGCTATCCGGTGACACAAACAGAGCATCGGAAATGCAGCTGGAA
CTTCATGGCTCGACCAGGGAAGGTTGTGACCCTGATCTTCGAGGATTTCG
ACCTGGAGAGTACCCTCGACACGGTGACCGTTGAAGACCCCTGCAGCGAC
ACGGAGCTGGGGAAGTTCTCTGGGACCACTCTTCCTCCACCTGTCCACAG
CAGCGACAAACAGGCCAGGGTCGTCCTCACCATCGGCACCACCGACCGCT
CTGTCCCTGGACGTGGTTTCAGGTTCAAATTCATCGCCACACCCTCTTCT
GCTAAACGAGGGGTTGACGAACCGCTGTCTGCCCAGCAGCCCGATGAGAC
CCTGCAGGGGCGTGGCCAGGAGGAGGCTGACAGAAACACCAACCAGGAGA
TGCTGATGGAGACCCTGAAGATACTGGAGGAGGACCTGCGTAATGCTGGC
AACGAGCTAGAGTATAATCATGAAGAGTGAGATGCCCGGCCGGAGATTGT
AAGCCTCGGCTGCTGGCGGGACAAGGCAGACAGAGCCATCCCAACCATGG
AGGGGTCGGACGCGCGTCTGGACGGGAGTTATCCGGCTCGTCAGGACGCG
ATCAACAAGTGCCGCAAGCTGACCGAGGCTCGAGGTTTCAACACCTTCGC
GCTGCAAAACGGAGGCTGGTGCGCTTCTTCAGCCACCGCTGCTCAAACCT
ACAGGAAGTACGGACCGTCCACAAGCTGCGCTACGGACGGCGAGGGCGGG
CCATGGGGGAACCAGGTCTACCAAATCACAGGACCGTCAGCATGTGAGGC
GCCACTGGATTTATTCCTACTTCTGGATGGATCTGGCAGCGTAGGGACTG
CAAACTTCGATAAGGTGAAACAGTTTGCTGCCGATGTGGTCAACAGCTTC
GACGTAAGCCCGACTGCCACCAGGATTGGTGTAGCACAGTACTCTGACAG
GAACTCCCTGGTGTTTAACCTGGGAGACAAGGCCGACAAGCCGTCCACCG
TGAGCGCCATTAATGGTGTCGCGTACCAGAGCGGCGGCACGAAGACCGGG
GCTGCTCTACAACACGTCCGTGATAACGCAGCATGGAGGGGCGGCGATGT
CCCGAAGGTGGTGATCGTGTTGACAGACGGAAAGTCCGGTGATGACGTAG
CGGCGGCTGCTCAGAGCCTGGCCGCCGACGGAGTGAAAGTGTACGCCATC
GGAGTGGGAAACTTCGATCATGGGGAGCTCATTCAAATTGCCAACAACGA
TCAAAACAACGTAATCGAGTTGAACAACTTTGATGCCCTGGCCACGAAGA
TTGACGAGATTGCCAAAGTTGTCTGCTCATATGTGTCAGACGCTTGCCCT
AGTGGCTACAATGGCCATGGTGGGATCTGCTACAAGGCATTCAACGCGAA
GAAGACCTTCCTCCAGGCGGCTAAGGCTTGTTACGCGGATGGCGGCACCC
TCGCCATGCCCCGGGATGCCGCCACCAACGACTTCATCAAGTCCCTGAAG
GACGCCATAGACCCGTCCGGTTTCTTCTGGTTCGGTCTGGTGGATCAGCA
CAAGGAGAACGAGTGGGTTTGGATAGACGGCCGGCCCCTCGGCAGCTTCA
GCGACTGGAAACCGGGAGAGCCAAACAATCTTGGCGACGAGGATTTTGCC
GAGTACTTCCCTACACAGTGGAACGACGTGGGCGGCAACGCAAAGAACAG
GAGATTCATCTGCCAAGTGATTCCAATCGATTGCCCAGAAGGCTACGTGT
ACCATCAGCCAAGTCGCACGTGCTACAAAGCCTTCGACGCCAAGAAAAGC
TACGACGGAGCAGTTGAAGCCTGTTCTGCAGACGGCGGTTCCCTCGCCAT
GCCCCGTGATGACGCCACCAACGTGTTCCTCATCTACCTGAAGAATGCTG
TCGACAACAGAGGCTGGTTCCGCTTCGGGCTGACCGATGAGCACCAGGAA
GGGGGGTGGATGTGGTCGGACGGCATCGCCCTGGGGAGCTACGAGCCGTG
GGGTCCGGGAGAACCGAATAACCTGAGAAACGAGGACTGTGGCGAGTACT
TCCCTGGAAGTCGCCCTAAGAAAACAAGAAACAAGTGGAATGACGGGCCA
TGTCCCAATAAAAACAGGAAGTTTATCTGCCAATTTATCCCGAAAGGATG
TCCCAAAGGGTACAAGCAGAGCGGTGCTAGCTGCTACAAGGCCTTCGACA
CTGACAAGAATTACGACGAAGCTGCGAAGGTTTGTCGGAATGAAGGAGGG
TCTCTGGCCATGCCTCGTGACAAGGTTACTAACGACTTCTTGATCAACCT
GAAGAACAAAGTGGACAGCACTTCGTGGTTCTGGCTCGGAGCGGATGACA
AGAATGACGAGGGTACATGGCGGTACANGGATGACAAGAATGACGAGGGT
ATATGGCGGTACATCGACGGTGAACCCTTCGGGAGCTTCAGCGACTGGTC
CCCGGGCGAACCGAACCAAGCCGGCGGGAACGAGGACTGCCTGGTGCTGT
TCGAAAGCCCCAGGGACAACTGGAACGACCAAGGCTGCGCAACAAAGCAG
AAATTCATCTGCCAGATCCATCTGCCAATCCATGACTCCTGTGGTGGCAA
TGTTCCCGGAGAGTTCGGAGTGATTGTCTCACCGGGCTATCCGGTGACAC
AAACAGAGCATCGGAAATGCAGCTGGAACTTCATGGCTCGACCAGGGAAG
GTTGTGACCCTGATCTTCGAGGATTTCGACCTGGAGAGTACCCTCGACAC
GGTGACCGTTGAAGACCCCTGCAGCGACACGGAGCTGGGGAAGTTCTCTG
GGACCACTCTTCCTCCACCTGTCCACAGCAGCGACAAACAGGCCAGGGTC
GTCCTCACCATCGGCACCACCGACCGCTCTGTCCCTGGACGTGGTTTCAG
GTTCAAATTCATCGCCACACCCTCTTCTGCTAAACGAGGGGTTGACGAAC
CGCTGTCTGCCCAGCAGCCCGATGAGACCCTGCAGGGGCGTGGCCAGGAG
GAGGCTGACAGAAACACCAACCAGGAGATGCTGATGGAGACCCTGAAGAT
ACTGGAGGAGGACCTGCGTAATGCTGGCAACGAGCTAGAGTATAATCATG
AAGAGTGA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97432gene:BL97432Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97432_cuf0-E1BL97432_cuf0-E1-1564476830-247778Branchiostoma lanceolatumexon
BL97432_cuf0-E2BL97432_cuf0-E2-1564476830-247775Branchiostoma lanceolatumexon
BL97432_cuf0-E3BL97432_cuf0-E3-1564476830-247773Branchiostoma lanceolatumexon
BL97432_cuf0-E4BL97432_cuf0-E4-1564476830-247771Branchiostoma lanceolatumexon
BL97432_cuf0-E5BL97432_cuf0-E5-1564476830-247769Branchiostoma lanceolatumexon
BL97432_cuf0-E6BL97432_cuf0-E6-1564476830-247767Branchiostoma lanceolatumexon
BL97432_cuf0-E7BL97432_cuf0-E7-1564476830-247765Branchiostoma lanceolatumexon
BL97432_cuf0-E8BL97432_cuf0-E8-1564476830-247763Branchiostoma lanceolatumexon
BL97432_cuf0-E9BL97432_cuf0-E9-1564476830-247761Branchiostoma lanceolatumexon
BL97432_cuf0-E10BL97432_cuf0-E10-1564476830-247759Branchiostoma lanceolatumexon
BL97432_cuf0-E11BL97432_cuf0-E11-1564476830-247757Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97432_cuf0transcript:BL97432_cuf0-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000061genomeSc0000061:1094885..1101819 -
Properties
Property NameValue
Transcript idBL97432_cuf0
Biotypeprotein_coding