Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97418_cuf5 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97418_cuf5
Unique Nametranscript:BL97418_cuf5
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97418_cuf5

>transcript:BL97418_cuf5-protein ID=transcript:BL97418_cuf5-protein|Name=transcript:BL97418_cuf5|organism=Branchiostoma lanceolatum|type=polypeptide|length=518bp
MVINKLPLVLFLLAATFDSGSAQCDETLRSPAGVISSPGYPGDYPPRVDY
TWCVDVEGATGIDVTFVGEFHLEINEDNDGTESCKDSVEIGSGNVPFQDS
IEVFCGNSTPPAQRVDTKQMWVNLYTDRNVEMSGFRLVYRSDLDVCYSSP
CTNGGTCVSDLTTYTYTCQCPPGWQGTNCEQDVDECASDPCQNGGVCSHE
VGVDFYQCTCEPGFTGVNCEIDIDECENVTCQNQGSCVDLVNDFFCNCTA
GWEGRFCENETNECESDPCLNNGTCIDLFNNYTCACTEEWIGDNCQLRNG
TTPCESNPCLNGGNCTEANDDYMCVCPPIYTGVNCEEILGPSAVCVSWGD
PHYITFDGTSVNFQGACTYNLVQAEARDSARPAFRILATNERRGSDRVSY
TAGAQVEIYQHVITLGLGRVVTLNGVQVTLPLQLAEGVSVRLSGRNVVLR
TDFDLRVAYNGNHRLEVSVPPAYTDNIQGLCGNFNNDPQDDLQKPDGTTA
SSHTEFGNSWEVDADDRY
Run BLAST on NCBI

mRNA from alignment at Sc0000110:5854..22383-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97418_cuf5 ID=transcript:BL97418_cuf5|Name=transcript:BL97418_cuf5|organism=Branchiostoma lanceolatum|type=mRNA|length=16530bp|location=Sequence derived from alignment at Sc0000110:5854..22383- (Branchiostoma lanceolatum)
TATCACAATGGATAGACCGAACTAGCTGACTCCAGCAACGTGTCTCTACC TAGGCGGGCCGTTTGCGTAACAGGTGTGTGCAAACACATCAATTACCTGA CAAGTTTAAAACGGACACACCCAGGTCACAGTGAGAGACCCCTCCCACGA CTCTCGATCAGAGGAGGCTCACGCCCAGACTTTTTTTTTTCATTCCCGAA ACGGACGCAGCATCGAGCGTCAACTTGAGGAACGTTTACCACGTTGGCCG ATCGCGACCGACTGGAATGGTGATCAACAAATTACCGCTGGTTCTCTTCT TGCTTGCAGCGACGTTCGGTGAGTGTTTCGTTCGTTGGTTCGTTTGCCCA GGCTTGGCGCTTTTGTGCCTCTTGTTTGTCCATGTGTATCTGACCCCCTA GTCTAGCGTTGCCAAAGCAGATTGGCCATATGCTGGACATGACTTCGGCC TTATACATTATCTAAGTACATGTACACTTAAACAGCGAACATTCAGACTT CACAAGAATTTGGATGCTTGTTCATCACGTAACGTAAAAACATGGCTTGA TTCAGGAGCGCGCTACGAGCGGTCAGAACTGGTTTTCTGCGAAAATCTCC GTCTACGAGCCAAGTACACAAATAGTATATCAAATGACAGTTATCCGACG AAAGGAAATGCTAACGAATGACTGAAACAGACATGATTGCTAACAGCTTT CGTAACAATGTAAAAATAACCTCGCGCAAGTTTATAACAATTGTGATCTA TGCGTACAGACTTGAGACAAGTCCACAAAAGTAAGTCAATCCTTTGTCCA AGCGTTTCAGAGTCGCACACGGTTTTCTACATATTACGTTCTGTCATAAA CTTTTATACACTCCTTTTACAAGTAGTTCTTATATATNGTCATAAACTTT TATACACTCCTTTTACAAGTATTTCTTACATATTAATTTTTCGTTCAGCT GTTCGAAACGAATCTTTTTATCACTAGATAAACACGAACCGTGTTTTACC TGTCTTATCTACCGTGTATTGTTGGTGGTTGTGTACCAAAGGGAAAAGTT TGTCAAAAATGTCCACATGTCCATTCGACCCCGTTAGACCTACAAAACAG AAAAAGAAGCCACCCACCAGTCAGCTTTTCCTGTTTGGAAAAGTACACAA ATCTGACATCTTTATAGTCACTGTAGGAAAACAAAACGCTGGTCACAAAT TCACTATATGTAGCAGGGCAATAAACAGTCGATGAATATCAGTAGTTTAT TGAGTAAATTATCGTAATAAATAAAACAATGAATAACACAGGTATTCCTA CCTCTACACCAAACAATTTTATTTCAGTTGTCGCTATAATAGTGGCTCAA GTCAAAGTGTATGACAACTGACCACACATTTGAACAGAGCATTTCCATCG ATCGAACTCTACTTGACTTGGAATTGATCCGTGAAATATAAACAAAATCC AAGCTGCATGAAGTATGACAACGTCGCATTAGCACATGTTATCAAAGTTG GACCTAATACTCGCTACATTTTATCTTATTTTTTTGAAAGTGCAACACAG CAATACACAGGAAGCTGTGCTGATGTCGGGTGCCACTGAACATACAGTAG AACATTCACGTATAAAATACTCGCGACATGACGACATAATTGCCACACGA AAAACGTTAACCCTTCCACCATTCGCATTCCTGCCGATATTGCGTGTGTA AATGTTTCTCCATTATGCATAAAAGAGCGAGGGGAGTACACCAAGACTTG CATATCTTGGTCGTGGATCTCAATGTTACTGAAAAGTACACAAATCATTT GCCTCAGAAACACAAGCTAACAGCGTCGTGCTTTTGTTAAAACAAAGAAG CAAACGAACAAATTTAAACAACGTCTTGGATACTGTTCTGACAGTTCCGC TTATGGGTCGAATGTGTACCTCATTTTAGCTAACGTATACTTAAATATCA TTGGTCAATTCAAAGTTTAGAAATAAATCCGTCGTTCAATCTCAGTCGAA TCAGAAGGGAGTGATATTTCTGGACTTGACCTACCTCTGGAATATAGGTT TTTCCTCAAAGATATACGAAAAACGATTGTATTCATTCAGCTTGGCATAA ATAAGTTAAGTAAAATAAGTGAGCTCAAATTGGAATCATGAAGACCTGAA TTACGAAATAAATTCTGGAGCTATAGCCAAACATATGCGAAAGTGGTTTT CCTGCTGCATGAACAATGTGACTCTTACACAAATTTCCTCAACAAACACA CTTATAATGCATGTCTGTGTACTAAATGACTGAAAAGAAAACTTTAACGT ACTCACACATTTGTGCCTACATTGCAGTCTTAACAACCCATGAAGCGGCG GGTCCCCCAACTTCGGACGTAAAATTAGGAGGTTAAATAGGCTACGTACT CGCACTAGGTCCCTCTAACAGGCCCAATCCAATGCCAGTTCACGCACATA ATTACCTATAAGATACTTATGACATTAGGATGCAAACAAAAAGTGTTGTG AGTGAGGTTTGGTATTGAAGGTCGATGAATTTACGACGGACAAGACCGCC GTGTGAACTCACACGTAGTGTTGTCGTTTGGAGCGATAAATGAACTATAA ACGCCTGACAATGTAAATGTTTTGAAAGGCAGATTTGGTCCATGAGTTCA GATCTTGCACGCCCCTCTTTCCTGCGGACCATACTTGTGCATTGAGTTTT ACCTTCATATTAATCACTCTAAACAACATCAACATGATCGACCTTCTGGC AAAGTTAAAAATGCCCAAAAGGCAATTTTTGTGCATAGTGCCTCTATTGT TGAACACGCTGAATCTCTGATACCTACGCTTTTTGACTGGACAGTTTAAA AGAACTCCTGAGATTTGGACTGTTCTCTGTGCATATCTATATTGTATTCA CAATGTGTTACAGTTGTACTGATCTTTTATTGTAATGTATGGTAATGTTT TTCCGCCTACCCCCGGAGGAATAGCTTATGAAAGGCAAGCTTAACGTGGA TGAAAAATAACCCAAAACTCAAGGGGCTTGTATCTCTTTGAAAATGAGGT TTCAACCGGTGGTTTGCTTTTGAATTGAATGTGAGTTGGTTTGAATGTCA TGTTGTGGGCATGAATTCCTTCAGCAAAGTCTGCCCACAAGTCAAATATT CAGTAGCCGTGAGTCTCGAGGAAGCATGACCCGACTCCACCCCCGCAATA CCACACGGCATGTCTGGTTTCTTCGTGCATGATGACTAGGTGTATGTGCA TATCTTCAATAATTCTGTTGAATCAACTATTTGTGCTCAAAGTTCTGGAC AAGTCTCTTTTTCCATAATAACTCTTATATTTTTGTGCACTTTTATGTAT ATAGTTATATCAGAGACAATTCTTTTACACAATTTCTGATATACTAATAA CCATGACCGCTAGCTATACATCTAACCACTCAATCCACTTCCTATATCAA TAAGTCCTCGGCCTCACCCAGAAATAAGGTGCACAACTCAAGTTTTGGAG CATAATTATGTAGTATGACATCTTTTAGCAATATCCACCAAACTTCAAAT CATTCTGATCATTACTTTACAGACGACACTCAGTAACATTACATGAGGTA GAAGGATAAAAACATGGACAATTGAGCTGTGACTTAAGGTGTGCGGGCCG ACTTGCTCTGCTGAAAGTCAGATACCCACTTCTTTTTAGTTGAAATAAGA AGGGAATCTTTATCAAACATATTGACAATGTCTTCGGAGATTTTATGCCG ATTCATGGCATGAAGAACTCGACCCACACAGCTCTGACCACAGTGTACCC TTGTTTTTCTTGTCACTTACCTAATAGTTTTCAAATGGACGTCGACTAAA AAGTATTGGCTACAATAATTTGAAATTTGGTGGATATTGCTATAAGATGT CAAACTACATAATCCTGCCCCAAAATTTGAGTTGTGCACCTTATTTCTGG GTGAGGCCGAGGACTTATTGATCACCCCTCGTATGTGTATGTATCGTCCG AATATCGCTGTTTGTAGCTAGCTGAAGTATGTATCAGTTTCTGCGGCGTT TCACCCTGCATTGGTTCTCAAGAAGCGTAGTGTTACTGTACCCTTTCTGC TGGGATAGCACGCATATTTGGTACGAGACGAAGGAAACCGCATATAAATC AGCAACCGAACCTTTTGGAAATGTACGAAGTCTGTCACACACACACGTCG CATTACGTCACCGAGAACATACGTTTGCCCCAGCCCCCACATTCGACACG TAAAGAACTTGAGTGGACCAAGGATGCTAAACCAAGCATTTAGAAACTTG ATCTGCGAGGTCTTTGTGCTTTTCTTTGTCCTTAAGTACATGTAGTTATT TTAAGACGGTCCAGACGTTCAGGGATAAAGGCGAGTCCTGTTTGCTCGGT CACGGATGATGTGGTCTTCATGGCCAACGTGGACAGGAGACAGTCAGCCA TGATAACTTCTAACCACACACGTGTGTATTTTACAGTCTTCAAAATTGAT TTGCGTTTGTACTCATGTATATGTGGTTTTGACAAACACGGAGGTAAATT CCTGCGACGTTTCCGAAAAAAGACAAACTGGTGCGGTCACTAATGGTCCG TTCTCTCGTCCTGCCACGCCTAATAACGGCGTGTTCCTACGTAACGCGTC ATCCGTTGAAAAGGTAGTCCCTGTCTAGTAGAAATACACTTTCTCCAATC CTAAAGCAAAGGAGAAGCGATGAAGGGAAGGGCCTGTTGGTGCCGATCGC GAGCAAAATGTAGCTAGCCTCCACCTGGCCTTCATTTCTTCCTTCCATGG ATCGTAAAATTCGGCAAAAAAAAAGAATGATTGTCAAGTAGAGTCAGTCC ACGGTGAGGATCAATATTTCGCCCACGCTTGCAAATGAAACTTTCTGGTA GCCAAAATTCCCTGGCAAATATTCTCCCTATAGCTGGCGTAGTTTGTCTG GTAGGGACACAAAATGTACACGGCCCAGAACCCGAATCTATCTGGCTTAA TTGTTCCTGACTGCCCCATCCACCTAAATTTATAATCCACATACACATTT AAAAGTGATATTTGTAAGTGTAGTTTCATCCATGAGATAACATCAGTGCT CCCATTGCGTATCAAATCGGCAACAGAGCGTAAGTGTCCCTTACCGGCCG GTGTACTTTTCGACCAAGCTGTCAAAATTGGAGGCCTACGATGTCATTTT CACCGTTTTCCTCAACGGTTTAACAAGCATCTTTCCTTCACTACCCAGAA ATCCCTACGACTGTCACATTGAATGCAAGAATTAATGTCTATTGTCTGGC ATCAAAACGCTGATAGTTTTATTTGTAAATAATTAATTGAACGTTGGCAG AATTTTACAGCAACAGGTGCATCACAATCAAACATTCGTAAGTAGCTATA TTTGGTTTGAAATGTGCTATCAGCGGTTATACATAGTGCACAAACTATTT TCCATCGTTAGTAACCCAACCTAGAACACAAATACCAAGTCCCATTATAG TCACGCACATTGTAAGAGTCAGCATCATGCATATTGTTCGTTTTTGAAGA GACCGTTTCAGTCAAATAATTGCTTTTACGTAAGGAAGTGTCGCATTGCG ATTTGTACAGGGTAAAGTTTCATAAGCAAGTGTTTGACTTCCTCTTCTTG CTCCGTTCCACGTCCTAAACTTGGCAGACATGTTGAACTAGTGTCAGGTA TTTCTGTCCAACCAGTGTCAGTCTGTCAGAGGCCAACATTGTCGTCGTGA CGTCCTTTGTTTACTCTGTTGGGTTAAGGCAGCCCAGGCTCGAAAATTCG TGTTCGAGTTCGGCCGCGTGCCTGGCCAGCGGCGCGGCCGAACTCGAACA CGGTTCGAAATGTTCCACTACGGAGCATTTCGGGGAGCGCAAGGTCTATT ACACAACACAATCATATATATCATCTCAGGTGTACGTATAAGTACAAATT TGTTTTATAGGCCAGGATTTGGATTGTATTACATTCTAAATGTTTCAATC AAATGATGGAAGTTGTCTCCTCCACAAATGTTGCATGAGCCGCGCCGGGT CCTACTAGCGCTGTTTTGACGGAGGTGTTCCAAATAGAACGGGAGGTTCT GTATGTTCGATATGGTGTTCGAATGGAACGGCCGTTACGTCAGAGGTGTT GGATTACGCGGGAGACAACGAGCTGCGTGTGTGAGATCGGGTTATGACTT TTCCGCAATTACGCGCAGCTCAAAACAACAGACTTCAGCTTTTGAGTAAT NAACGAGCTGCTTGTGTGGGATTTGGGTTATGACTTTTACGCAATTACGC GCAGCTCAAAACAACAGACTTCAGCTTTTGAGTAATCAAATGTAACTTAT TATCGCTTTCTTATCAAAATTGTCCGAGGCTATTTTGCATAGATTTTATC TATTTTTAACCGGGGCGAATTTTCTATAAAAAATGACTCCAAAATAGCTG TTTCTGATGTTTCTGACCCAAAAAATCAATTTAATCGTCATTTTAAACAA AATAGCCTCGGACAAAAATGATTTGTATGGGGTTAGCTATTTCCTTGCAA AATATTATGATGAAAGGTGGTGTTACCGCCTGCGCGCATAAATCCATAAA ATACACGTTTTTTTTAACCAAAATGTGTATTTCTAACCCAAAATCCAGCA GTAGAAAAACTTAAGTCACCTTTATTCAATGTGTTTTAAGTAGTTCTAAA TCTGTTTCAAGTTTCATCGTGGTGCGACAAGGCTATCGATAGTTACAGAG TATAATCATATATGTACAGAATAATACCTCCTGGGCCGCCTTAACCCAAC TGAGAATTGTCGGTATGAATTGGTCCATCGAAGGGGAACATGTCGGGACA TAAACTACAAACCAGGCCAAACAAGCCACTTTGATATCAGTCACGGTGTT TGCAACAGTCTACGATAAGGAATGCGAGCCTAGGCGCCTACAGATGGCTC GTTCTCATTTATGTAGAGACCTTGTATTGTTGTTGTTGCTATCCTAATGG TGTTGGCCTTGAAGGTTGTATTGGACCATATTCGTCTTTTAGTGTATATC GTTTTATGATCGAAAAACAGGCATCATTCGGATCTTATTTGGACACATTG TCTGAACAACCGGAGCCGTTCACTCAGGACTGTGCAAGGGCCTTAAGGAG AACCCTGGGCCACTCATAGCATTTTCTAGTAGGAAAACTCTGCTTGAGCA GCCCAAAGCTCCTCACACACAGCCCCAAGTCGACTCCGAAAACCTGTTTG TAAATTGGCCCCGAGTGTGCTTGGAAATGCGTGTGTAAACCCAGCCATAG ACTCCGTTGGCGTTGCAAACCCTACCGAACATGTTTTCCGATTACATAAA CGGTATATCCTATATACATATCGTATATACATTAACCAACAGAAAATACA CGCTCGACGGGGTCTGAGGCTAAAAGACATCAAGGATCAATCTCGTAAGG GAAAAATAGTAAGAGAAACTAACGCCCCTGTTGACATTACTATTATTAAG GAGACTTTTATCCACTAATTAGATAGGTGACGCAGGCATGTCACCATTAC TTACTGATAAAGGGACAGGTCATGACGTCCATACTCAATTTAGAACTATA ATTGAGTGGTTACTATCTATTACATTATGTTTGCAAAGGTTTGGATTTCT TTATATTAAGTGTTATACCCCCATTCCACTAGGACGGCGCTCTCGCCGCG AGCTCTCTGCGACCTAAAATTTGACAGAGCGCTCAGAAAATTTCAAGGAT AATTTTCATGCTTTGTGTGTTTTGGTGTTCAGTTGTACTTTTACATTTTG CATGAAATTCCAATGATGAAGTCAAGGGTTACACAAATCCGATATGAGTC GCAGCGCGATCGCCGTCTAGTGGACTAGGGGCTTGTAGTTCGGTTGCAGA AGTACAAAGTGGGGGTTCAACTCCAGGTCTAGTCGTCGGTGTTCGAATCT CACCTTGCCGTCGGCCTCTGAACCTGATATGCGTGCAAGTGAAGTGACGG GGGATGCGGTCATTCGAAATGGGCATTCAAAAGCCAGAGGATCAGATTTA AGGAACCCACGCACATTGTAAACGTAAAAAAGCACATCAGACTTCTCAAA AAGAGAGGCGGTGTTTTGAAGACATGGTGAAGCATGTGGAGTGTTGTCCA GGTGCGAGTGGCGTTGAATAAATCATTAAAATTTTTATTTTAATGTATTT TCGAGTTATACACAACTGTTAACATGTTGCAACTGTAATTGTAGTAACAG GTGTAGTAGCGCTAGTCGGCTGGTTTCTTGTTGGGTGTAGCAAGTACCTG AAGCCGGCTTTAGCTTGTTGTCGCCTCCTTAAAACACTCATGTGAAAGAA ACGTTATCGGGATAACAGGTGTAGCATAGCAGACAGTTGGTTTCTTGTCG GACGCTACCTTAAACCGTCTCAAATCACTCGTGAAAAAGCATGTGTGCAT GTATTGGCCTGTTTGTTTGGCTAGATATTGTTAGGTGTTACCTAAAGCTT GTTGTCGACTCCTTAAACACTAGTGAGTAAGAACCGCTTTTGGAAAAACA ATCGTCATTGGAATAACATGTGTAGTAGTCTCCTTGTTTCTAGATCTTTT CGGGTGTCATCTAAAGCTTGTTGTAGCCACCTAAAAACATGCTTGTGTGA GAACCGTTACTGCAGTAATAGTCTCCCTGTTTCTAGACCTTTTCGGCCGT GTTGTTGCCTTCTTAAAACAATCTTGTGTAGAATCTTTATTGGAATAACA GGTGTAGTAGCCGCCTAGATCTTTCATGCAGGGTGTTACCTAAAGCTTAC TGTCGCCGTCTTAAAACACTCTCGTTAAAGCAGTAACAGGTGTAGAAGCC TGCTTGTTGTTGGGTGTTACCTAAAGCTCGTTGTCGTCGCGCCTTATCGT CCAGCATGTTTATTCGGCATTTAAGGTCTCTGCTTGCACAGGGTGTCGCC GCTCTGACACGGTGGCATGTAGAGGTCACCTTCTGACGTCGTAAGCCTTG TTTCAGAGCAATGCGTGGGCGGGGAGCTGCAATAAAGGGAACCGTGGTTT GATGGATTGTGCGTACCTTATCTCATGCAGACGCTATGTTCAGGCACGGT TTAGTACTTCCAAATCCGCCAACTAAACTTCTCGTGGCGTTTAGTTCACT ACAGGATAGCTTTGAACTGTAACCATTGTACCAGAACACGCTGAACCTCA AGTTGGTTCAACTATAATTACAACTACAACTACAAACTTTTTTGCAGTGA CTATAAGCCAGCCGACCTCCCAGTCACTCGTCACCAATGTTGCAACTGGA TCAAAGTTCATGGTCCTCATATCTTTTTAATTACTGAAGGTTATGGTCAT TAAAAGGTTCTTATCTGGTACGGTTTTCCGTTCCCAAAGACAAATGTCCT GTGCTGTCATATTAACCTTAGCACACTGAAGTGGCTGATTGACACCCCGT TCTCTATTGGTTACAGAGTTAGGCAGCAGGGAGAAGGTTAATAACGTGCG CCTGTGGGATTAATAGGCGGGTGGTTAGGGCGGGAAACGTGAACAATTGT GGCCACTACTAGCCGTCCGACCGACCGAAACCTCGCCTGAAAATGAGGCA AATCGCCAAGCAAATCTGGAAGGAAGTGAAACAAAGGAGACGCCTGGAAT AGTTTTATGAACATTTGACATACGTCCTTGTTCTAAAAAGTCCGAGTAAT GCTTTGTTTGAGCCGCATGGGTGGACATTTCCACCAAGGGTGCAAAGAGA ACAATCGTTTCTTGGCGTAATCTCTTAAAGACAAACATTCTTAGAGCGTT TAGTGATGGTTAACGTATAAATCTCACATTCCATTCTATGGCAACAAACC TGTCTTGACAGACACCACAAAAGTTTTGGGTACGGGAAAGGGAAGCGTCT GTTTTTCAATCGCAGTGTCCGACGCCCTAGAAATACACCGTTAGACAAAC ATGTACACAGGCGATTTACAAGAACAACAAAAACGGAATTAACGTATAAA TCTCACATCGCATTCGATGATTATGAATCTGTCGTTAGTTCACATGACAG ACATCACAAAATTTGTGGTTAGGCCGCCATTCCACTAGACGGCGATCGCG CTGCGCTCTCGCTGCGACCTAAATCGGGGTTGTCTAATCCTTGATTTCAT AATTAGAAAACCATGTAAAATGTAAAAGTGTGGCTGAAAAGATAGCAAAA CACAAAAAGCGTAAAAATATTCGTTTTAAGCTATGAAATTAGTTGAGCGC TCTTAAGATTTTAGGTCGCAGAGAGCGCGTGGCGAGAGCGCCGTCCTAGT GGAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNACATGACAGACATCACAAAATTTTG GTTAGGCCCCCATTCCACTAGACGCTGCGCTCTCACTGCGACCTAAATCT GTTTTGTCTAATCCTTGATTTCATAATTGGAAAACCATGTAAAATGCAAA AGTACGGCTGAAAAGACAGCAAAACACACAACGTGTAGAAAGATTCGTTT TCAAGTTATGGAATTTGTTGAGCGCTCTTAAATTTTAGGTCGCAGAGAGC ACGCGACGAGAGCGCCGTCCTAGTGGAATGGGGGTATTACAGGGAAGAGA AACGTCTGTTTTTCAACCATATATTGTATCCGACGCCCTAGAAATACATC GTCAGACAAACATGTACACGGGCGATTTACAGAGACAACAAACCCCATGG TCTGAAGGGGTGGAAAAGCGTCTGCACGAATCATTGATGTGTGCACAGGT TGTTTACCCAACAGCTACTTTCTTGTCAGAAGTGCGTGTGGTGATTCTCT AAATATTTGTTTAGCAACCACTGAAACAGGTCAGAAAAAAGGGTGACAGT TGTTCCTTGTAATAACGGATTATATATGGTCAGCATATCGCCTGATTTCT AACTTCGCATATTGCACTTAGTTGACTACTGTTGTAAAATGATATGCTAG GTATCTACTTTGCACTGCTAGATCTAAATCCAATCTTGAGACGTACACGT CCTTGAGATCCGTTTGCTTGCAATTGGGTCGTCGCGACTTTGAAAAATCT TACAATCACAATCACTAAACATAAACAACCAGAAAGTGGTTTAGCAATTG AGACTTGGGGATCTTTGATATCCACACGTACAATTCCTTCACAAATACAG TTGTTAAGATATATAGCAGTGAAACGTAGACCTTTTAAAATATGATTTTC GTGATAGTCGTAACTTCTCCTTTTTGATGCTTTGTATTTACAAATGATTA CCTTGTGGATAAGCGTGTATAAATTGTCTCAACATGAGCGAAATAAGTCC AATCAACTGGTTCAATGCGCTTACATTGTTTCTGTGTTTGTTTAGATTCC GGAAGTGCACAATGCGATGAGACACTACGGTCCCCGGCAGGCGTGATATC CTCGCCGGGGTACCCAGGCGACTACCCGCCGAGAGTAGACTACACGTGGT GCGTCGATGTGGAGGGAGCTACAGGTATGTACAAAACTATAGGAAGATAC AGACAGACAGAGACAGAAAGAGAGACAGACAGATAAAATGGGAGATAAAC AGAAAGAGAAGAGAGGGGAGAGAGGGAGAGAGAGAGAGAAAGATGAAATA GACTGAGAGATGAAGACATAAAGGAAGCGAAAGAGAGGGCAACGCTGTGA AATGACGGATGAAGAGAGAAAGACAAAGCTAAGGAAATCTCGTCTTAAAT CGCCATCTCTAGAATCGGAGGGATCAGCAGTAGATTAGGATGATAATTAC CCAATAAGATTACAACAAGTGTTCCGGCAGTTGAATAATCACATTACTTT TTACGTCATTTCAGGCATAGATGTCACTTTTGTGGGTGAATTCCACTTGG AAATCAACGAGGACAATGACGGAACAGAATCATGCAAAGATTCTGTGGAG ATAGGATCGGGAAACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTGTGG AAACAGCACCCCGCCGGCACAGAGGGTGGACACCAAGCAGATGTGGGTGA ACCTGTACACAGACAGGAACGTGGAGATGTCAGGGTTCCGACTGGTATAC AGATCAGGTAACACGTTATGTAGTCTGTAGTCATAATTAGTACTTTCGCC AAGAAGTTAATGTTTTCGGTGCTGCTTGTGGGTTTGTTTGTAAATGAACA GCATAAGTGTCAGCAAAAGGAAAATCCGGGTTTGATATGTAATATTTTGG ACATACTATGATTATGATTTTTTTCGGTGATAGATACTAATAATGTTAAT GGTAACCATACAAGCGGTCAGATCATAATGATTGTAATGATTATGTCCAG TAAGTCACATCATTTAAAGTGCTGTTCATGGTACGCTTGTTCTGCCAACG TCTTGATTGAAGCCTGTGACATTGCCGGCGATTCCCGATATGCAGCTGAA TGATAAGCACATTTATTGTTTACGATCTTCAAGTTTTCTGTGCCGACCAT TCTATGTTTTATCATCCTCCAGACCTGGACGTATGCTACAGTTCTCCCTG TACTAACGGAGGCACGTGCGTTTCCGACCTGACAACCTACACATACACCT GTCAATGTCCACCTGGATGGCAAGGAACTAATTGTGAACAAGGTGAGATA CTATTATATAATTGTAACTACTTTGTCATATCTTAATGTCCTTTATCATT CAAGGTCGAAACCATTACTTTGAGAAATAAAAAGAAAAGATCACAGCCCA TGAACAATGTTTAACTTATTTCTCTTTTGCCGACTCCGTTTGAATATCTA TTCGAATAAAAGTCCTCAAATCAGGGCATGGTGACACCCATTACGGAATA GATACTAAACACGTATTACAGTGAAAATGAGTTAATCATTGTTTTCTGGA TTCATTCTGAAAGTTATTTCTTTTTTTTCACTTCAGATGTGGATGAGTGT GCCAGCGATCCTTGTCAAAATGGCGGCGTGTGTTCACACGAAGTCGGAGT TGATTTCTACCAATGTACCTGTGAACCAGGTTTCACTGGAGTCAACTGTG AAATAGGTGAGTGGTTAACTTTTAACAATAGAAAAAACTTCACAACCTAA TCATCCTCGCTTGTTGAATAGTTTCCATGCCAATTTCTCCCAGTCTTACA AACTTATTACAAGAACATTGTACACGCAAGTACATGTAAGGCATGTTTAA TGGAATTCCCATTAACAACTAAATACATTTCGTGAAGCTGCAATAACACT ATACTTCCTTGAAGTTATTCTTGATTTTCCTATGCGGTTATGATACTATA AAGTTGATGAATATATTCACCGTTCGTCTGTAAAACTCCACATTGCTTTG ATTTTATTTATCTAGATATCGACGAGTGTGAAAACGTTACCTGTCAGAAC CAGGGCAGCTGTGTGGACTTGGTCAACGACTTCTTTTGCAACTGCACCGC AGGATGGGAGGGACGATTCTGTGAAAACGGTAGGATAAACTTTTGGTTAT TCGCCGTCTTCAGATCCTTGCTCACTGTCGGTACATGTCTCGAACATTTA TTGACAGTACTTTCTGTAACATTGAGAATGAAAGATTTCGTCATCATCAT CATCATCATCATCATCATCATTATCTATCCAATTGGAGAATGCTAAATTC CACCTTTGAATACCATGGCCCTACCACTACGTGTCAAAAAAGGTTTATTG GTCAGAAATTACCAGTGCAATGGCAGCCAGTGCTGAATTGCCGCAGTGTT TACAATCACATAATACACAACAGACACATATTTGCTCCACACTTGCACTT TGTGGAACTGTCTCAAGGGTCTGGTCGGCTGCCATCCGGCGCCAGCAGGT GACCTCAATGCGACCTTCCCCAACCGAAGCCAGGAACTCATTCACACCTG GGTAGAGTGAGGAAAGTCGTTTTAAGTAGCCTTTCCCAAGGGTACAAGAT CGGGGCATAGCAGAAGGTTTCGAACCCGGGACCCCACCGATTGCGCCACA CGATGCACTGGGTTTTACCTAGCCTGTTATCACCTTTATACTGTTTATAC ATTGTTTTGTTATTTTACATCATCAAGAATTAATCATCTTTCAACAGAGA CGAATGAGTGCGAGAGTGACCCGTGTCTCAACAACGGAACGTGCATAGAC CTCTTCAACAATTACACCTGCGCATGCACAGAAGAATGGATCGGAGACAA CTGTCAACTCCGTACGTTACCAAATTATTTTCATTTTTTTTGTTATTTCT TTACTAATTTTAATTTGATTTTTAACGAAAAATAACAAACAGTGTCAGAC ACAGTGAGGAAATCATCCAGCGAAAGGATAAGCCATTACAATATCCAGAT AATATGATTTGTTAGCAAAATGTTAATGAATTTTGTAGATTACACCATCA TCTAGTAAAGTTGCCTGTCATGACAATGGTCGAAAGCTCAAGGTTGAGAT TAAAGGTATCACAAGACACGATTATACTGAAAACAAAGCTGTGGAGCGTA GGCCCGTGCATCCTTATAAATTTGACCTTGCATGTTGGCACACGCTGTGA AAAACACACACTATTACATACATGACACAACCTGAGCTGTTCCAGTCAAG TTTAATGTTGTTTTTTTAAATGAACTACAAAAAAACTGAGGAATAATTGT GCCATTTGACTCGCCGTCCTGATTGTTATGAAATTTTCTCCGTAGGTAAC GGCACCACTCCCTGTGAGTCTAATCCCTGTCTGAACGGAGGGAACTGTAC AGAAGCTAACGATGACTACATGTGTGTGTGCCCGCCGATCTACACAGGAG TCAACTGTGAAGAGAGTAAGATATTCTTCTCAGTCCCTTTTGAGGATTTT TCGAAAAAAGTCTCTAATATGTAAATGAATCAAATATTCATTCAATATTT ATATCTATCTTTAAAAGATTAACTACATACTATAGGTCGGCACAATACGT TTAACTTGAGGCTACCTAGACATAAATGAGAACTGGGTCAGATTGATGAG AGAGAGAACAAATGAAGTCACTCATGTGGTTTAAACAATATAGATGTGCC TGCAAAGGTCTTAGGTGAACATGCCGTATGTAGTGAATGCTTAGAAACAA ATTGATGATTTCCAACGTTTTTTCGTCAAGCTAGCTAGGTTCTGCATAAC ATTCCCGACTCATTTTGAAGTCTAGTTTGTTGGAATCACATTACATGTCG AATCAAATATACTGGCAACATACAGCTTGTTTAAAGATATATTAAACATA GAGGCTTGGGAACGAGTTTAGTACACACGGTGTAGTGTAGTATGACATCT TCAGCTAAGGATTATAAACATCGCTTAAAACAAATTCAAAGACGATAGGT TTACGTCTTTATGTCTATTCATTTAAAGTTACATCTGTGAGAGCTTTAGA TCTGCTTAACCATTGGCTATCACAAAGGAAACATGTATAACATATACATG TATTTTTTGGTGCAGTCCTTGGACCTTCAGCGGTATGTGTCAGCTGGGGA GATCCACACTACATCACGTTCGACGGCACAAGCGTGAACTTCCAGGGCGC GTGCACGTACAATCTCGTTCAGGCAGAAGCGCGAGATTCCGCGAGACCGG CCTTTCGGATCCTGGCGACCAACGAACGGAGAGGGTCGGACCGCGTGTCG TACACGGCCGGGGCGCAGGTCGAGATCTACCAGCATGTCATAACGTTGGG ACTAGGCCGAGTGGTGACGGTAAGATGATTGTAGTACTCGAATTTCTTTA ATGTGCATCATTAACATTGAATACATGGAATAACGTGTTATTCAGGGTTT GGGTAAAACATATCCACGTTTGACCCCAGATTATTTGATGTTGCTGAGTT TCTTCCAGTTCGTTTTTCTTGGGTCAATGTAATACTTTTCTTTAAGAAAT CTAGTTTTCTGCACATCCCTCGTTTGCTTCAGACACTCGTTGAAAAGAAT GCTTTATGTCTTGAAACATTTGGTCACGTCCGCTCCGAAACTTACACCCA CGTTCAAGATAATATTGCAATGATTTATTATATGAAGAAATAAAACACAG TACCAATAAATTGTAAGCCACTGGAACATAAATAGACACACCCATACACA TTCCCAAAACTCATGTGTTATCTCTACGTTATATCCTCCAGCTTAACGGC GTCCAGGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCT CAGCGGTAGGAACGTTGTCCTCCGGACGGATTTTGACCTGAGGGTGGCTT ACAACGGAAACCACCGTCTGGAGGTCAGCGTCCCACCGGCATACACCGAT AACATCCAAGGCCTGTGCGGAAACTTCAACAATGATCCACAGGACGACTT GCAAAAGCCGGATGGCACCACGGCCTCAAGCCACACTGAGTTTGGAAACA GTTGGGAGGTTGATGCCGACGACAGGTATG

Coding sequence (CDS) from alignment at Sc0000110:5854..22383-

>transcript:BL97418_cuf5 ID=transcript:BL97418_cuf5|Name=transcript:BL97418_cuf5|organism=Branchiostoma lanceolatum|type=CDS|length=15540bp|location=Sequence derived from alignment at Sc0000110:5854..22383- (Branchiostoma lanceolatum)
ATGGTGATCAACAAATTACCGCTGGTTCTCTTCTTGCTTGCAGCGACGTT
CGATTCCGGAAGTGCACAATGCGATGAGACACTACGGTCCCCGGCAGGCG
TGATATCCTCGCCGGGGTACCCAGGCGACTACCCGCCGAGAGTAGACTAC
ACGTGGTGCGTCGATGTGGAGGGAGCTACAGGCATAGATGTCACTTTTGT
GGGTGAATTCCACTTGGAAATCAACGAGGACAATGACGGAACAGAATCAT
GCAAAGATTCTGTGGAGATAGGATCGGGAAACGTCCCGTTCCAGGACTCC
ATCGAAGTCTTCTGTGGAAACAGCACCCCGCCGGCACAGAGGGTGGACAC
CAAGCAGATGTGGGTGAACCTGTACACAGACAGGAACGTGGAGATGTCAG
GGTTCCGACTGGTATACAGATCAGACCTGGACGTATGCTACAGTTCTCCC
TGTACTAACGGAGGCACGTGCGTTTCCGACCTGACAACCTACACATACAC
CTGTCAATGTCCACCTGGATGGCAAGGAACTAATTGTGAACAAGATGTGG
ATGAGTGTGCCAGCGATCCTTGTCAAAATGGCGGCGTGTGTTCACACGAA
GTCGGAGTTGATTTCTACCAATGTACCTGTGAACCAGGTTTCACTGGAGT
CAACTGTGAAATAGATATCGACGAGTGTGAAAACGTTACCTGTCAGAACC
AGGGCAGCTGTGTGGACTTGGTCAACGACTTCTTTTGCAACTGCACCGCA
GGATGGGAGGGACGATTCTGTGAAAACGAGACGAATGAGTGCGAGAGTGA
CCCGTGTCTCAACAACGGAACGTGCATAGACCTCTTCAACAATTACACCT
GCGCATGCACAGAAGAATGGATCGGAGACAACTGTCAACTCCGTAACGGC
ACCACTCCCTGTGAGTCTAATCCCTGTCTGAACGGAGGGAACTGTACAGA
AGCTAACGATGACTACATGTGTGTGTGCCCGCCGATCTACACAGGAGTCA
ACTGTGAAGAGATCCTTGGACCTTCAGCGGTATGTGTCAGCTGGGGAGAT
CCACACTACATCACGTTCGACGGCACAAGCGTGAACTTCCAGGGCGCGTG
CACGTACAATCTCGTTCAGGCAGAAGCGCGAGATTCCGCGAGACCGGCCT
TTCGGATCCTGGCGACCAACGAACGGAGAGGGTCGGACCGCGTGTCGTAC
ACGGCCGGGGCGCAGGTCGAGATCTACCAGCATGTCATAACGTTGGGACT
AGGCCGAGTGGTGACGCTTAACGGCGTCCAGGTCACCCTTCCGCTCCAAC
TAGCGGAGGGCGTCAGCGTGCGCCTCAGCGGTAGGAACGTTGTCCTCCGG
ACGGATTTTGACCTGAGGGTGGCTTACAACGGAAACCACCGTCTGGAGGT
CAGCGTCCCACCGGCATACACCGATAACATCCAAGGCCTGTGCGGAAACT
TCAACAATGATCCACAGGACGACTTGCAAAAGCCGGATGGCACCACGGCC
TCAAGCCACACTGAGTTTGGAAACAGTTGGGAGGTTGATGCCGACGACAG
GTATATGGTGATCAACAAATTACCGCTGGTTCTCTTCTTGCTTGCAGCGA
CGTTCGATTCCGGAAGTGCACAATGCGATGAGACACTACGGTCCCCGGCA
GGCGTGATATCCTCGCCGGGGTACCCAGGCGACTACCCGCCGAGAGTAGA
CTACACGTGGTGCGTCGATGTGGAGGGAGCTACAGGCATAGATGTCACTT
TTGTGGGTGAATTCCACTTGGAAATCAACGAGGACAATGACGGAACAGAA
TCATGCAAAGATTCTGTGGAGATAGGATCGGGAAACGTCCCGTTCCAGGA
CTCCATCGAAGTCTTCTGTGGAAACAGCACCCCGCCGGCACAGAGGGTGG
ACACCAAGCAGATGTGGGTGAACCTGTACACAGACAGGAACGTGGAGATG
TCAGGGTTCCGACTGGTATACAGATCAGACCTGGACGTATGCTACAGTTC
TCCCTGTACTAACGGAGGCACGTGCGTTTCCGACCTGACAACCTACACAT
ACACCTGTCAATGTCCACCTGGATGGCAAGGAACTAATTGTGAACAAGAT
GTGGATGAGTGTGCCAGCGATCCTTGTCAAAATGGCGGCGTGTGTTCACA
CGAAGTCGGAGTTGATTTCTACCAATGTACCTGTGAACCAGGTTTCACTG
GAGTCAACTGTGAAATAGATATCGACGAGTGTGAAAACGTTACCTGTCAG
AACCAGGGCAGCTGTGTGGACTTGGTCAACGACTTCTTTTGCAACTGCAC
CGCAGGATGGGAGGGACGATTCTGTGAAAACGAGACGAATGAGTGCGAGA
GTGACCCGTGTCTCAACAACGGAACGTGCATAGACCTCTTCAACAATTAC
ACCTGCGCATGCACAGAAGAATGGATCGGAGACAACTGTCAACTCCGTAA
CGGCACCACTCCCTGTGAGTCTAATCCCTGTCTGAACGGAGGGAACTGTA
CAGAAGCTAACGATGACTACATGTGTGTGTGCCCGCCGATCTACACAGGA
GTCAACTGTGAAGAGATCCTTGGACCTTCAGCGGTATGTGTCAGCTGGGG
AGATCCACACTACATCACGTTCGACGGCACAAGCGTGAACTTCCAGGGCG
CGTGCACGTACAATCTCGTTCAGGCAGAAGCGCGAGATTCCGCGAGACCG
GCCTTTCGGATCCTGGCGACCAACGAACGGAGAGGGTCGGACCGCGTGTC
GTACACGGCCGGGGCGCAGGTCGAGATCTACCAGCATGTCATAACGTTGG
GACTAGGCCGAGTGGTGACGCTTAACGGCGTCCAGGTCACCCTTCCGCTC
CAACTAGCGGAGGGCGTCAGCGTGCGCCTCAGCGGTAGGAACGTTGTCCT
CCGGACGGATTTTGACCTGAGGGTGGCTTACAACGGAAACCACCGTCTGG
AGGTCAGCGTCCCACCGGCATACACCGATAACATCCAAGGCCTGTGCGGA
AACTTCAACAATGATCCACAGGACGACTTGCAAAAGCCGGATGGCACCAC
GGCCTCAAGCCACACTGAGTTTGGAAACAGTTGGGAGGTTGATGCCGACG
ACAGGTATATGGTGATCAACAAATTACCGCTGGTTCTCTTCTTGCTTGCA
GCGACGTTCGATTCCGGAAGTGCACAATGCGATGAGACACTACGGTCCCC
GGCAGGCGTGATATCCTCGCCGGGGTACCCAGGCGACTACCCGCCGAGAG
TAGACTACACGTGGTGCGTCGATGTGGAGGGAGCTACAGGCATAGATGTC
ACTTTTGTGGGTGAATTCCACTTGGAAATCAACGAGGACAATGACGGAAC
AGAATCATGCAAAGATTCTGTGGAGATAGGATCGGGAAACGTCCCGTTCC
AGGACTCCATCGAAGTCTTCTGTGGAAACAGCACCCCGCCGGCACAGAGG
GTGGACACCAAGCAGATGTGGGTGAACCTGTACACAGACAGGAACGTGGA
GATGTCAGGGTTCCGACTGGTATACAGATCAGACCTGGACGTATGCTACA
GTTCTCCCTGTACTAACGGAGGCACGTGCGTTTCCGACCTGACAACCTAC
ACATACACCTGTCAATGTCCACCTGGATGGCAAGGAACTAATTGTGAACA
AGATGTGGATGAGTGTGCCAGCGATCCTTGTCAAAATGGCGGCGTGTGTT
CACACGAAGTCGGAGTTGATTTCTACCAATGTACCTGTGAACCAGGTTTC
ACTGGAGTCAACTGTGAAATAGATATCGACGAGTGTGAAAACGTTACCTG
TCAGAACCAGGGCAGCTGTGTGGACTTGGTCAACGACTTCTTTTGCAACT
GCACCGCAGGATGGGAGGGACGATTCTGTGAAAACGAGACGAATGAGTGC
GAGAGTGACCCGTGTCTCAACAACGGAACGTGCATAGACCTCTTCAACAA
TTACACCTGCGCATGCACAGAAGAATGGATCGGAGACAACTGTCAACTCC
GTAACGGCACCACTCCCTGTGAGTCTAATCCCTGTCTGAACGGAGGGAAC
TGTACAGAAGCTAACGATGACTACATGTGTGTGTGCCCGCCGATCTACAC
AGGAGTCAACTGTGAAGAGATCCTTGGACCTTCAGCGGTATGTGTCAGCT
GGGGAGATCCACACTACATCACGTTCGACGGCACAAGCGTGAACTTCCAG
GGCGCGTGCACGTACAATCTCGTTCAGGCAGAAGCGCGAGATTCCGCGAG
ACCGGCCTTTCGGATCCTGGCGACCAACGAACGGAGAGGGTCGGACCGCG
TGTCGTACACGGCCGGGGCGCAGGTCGAGATCTACCAGCATGTCATAACG
TTGGGACTAGGCCGAGTGGTGACGCTTAACGGCGTCCAGGTCACCCTTCC
GCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCTCAGCGGTAGGAACGTTG
TCCTCCGGACGGATTTTGACCTGAGGGTGGCTTACAACGGAAACCACCGT
CTGGAGGTCAGCGTCCCACCGGCATACACCGATAACATCCAAGGCCTGTG
CGGAAACTTCAACAATGATCCACAGGACGACTTGCAAAAGCCGGATGGCA
CCACGGCCTCAAGCCACACTGAGTTTGGAAACAGTTGGGAGGTTGATGCC
GACGACAGGTATATGGTGATCAACAAATTACCGCTGGTTCTCTTCTTGCT
TGCAGCGACGTTCGATTCCGGAAGTGCACAATGCGATGAGACACTACGGT
CCCCGGCAGGCGTGATATCCTCGCCGGGGTACCCAGGCGACTACCCGCCG
AGAGTAGACTACACGTGGTGCGTCGATGTGGAGGGAGCTACAGGCATAGA
TGTCACTTTTGTGGGTGAATTCCACTTGGAAATCAACGAGGACAATGACG
GAACAGAATCATGCAAAGATTCTGTGGAGATAGGATCGGGAAACGTCCCG
TTCCAGGACTCCATCGAAGTCTTCTGTGGAAACAGCACCCCGCCGGCACA
GAGGGTGGACACCAAGCAGATGTGGGTGAACCTGTACACAGACAGGAACG
TGGAGATGTCAGGGTTCCGACTGGTATACAGATCAGACCTGGACGTATGC
TACAGTTCTCCCTGTACTAACGGAGGCACGTGCGTTTCCGACCTGACAAC
CTACACATACACCTGTCAATGTCCACCTGGATGGCAAGGAACTAATTGTG
AACAAGATGTGGATGAGTGTGCCAGCGATCCTTGTCAAAATGGCGGCGTG
TGTTCACACGAAGTCGGAGTTGATTTCTACCAATGTACCTGTGAACCAGG
TTTCACTGGAGTCAACTGTGAAATAGATATCGACGAGTGTGAAAACGTTA
CCTGTCAGAACCAGGGCAGCTGTGTGGACTTGGTCAACGACTTCTTTTGC
AACTGCACCGCAGGATGGGAGGGACGATTCTGTGAAAACGAGACGAATGA
GTGCGAGAGTGACCCGTGTCTCAACAACGGAACGTGCATAGACCTCTTCA
ACAATTACACCTGCGCATGCACAGAAGAATGGATCGGAGACAACTGTCAA
CTCCGTAACGGCACCACTCCCTGTGAGTCTAATCCCTGTCTGAACGGAGG
GAACTGTACAGAAGCTAACGATGACTACATGTGTGTGTGCCCGCCGATCT
ACACAGGAGTCAACTGTGAAGAGATCCTTGGACCTTCAGCGGTATGTGTC
AGCTGGGGAGATCCACACTACATCACGTTCGACGGCACAAGCGTGAACTT
CCAGGGCGCGTGCACGTACAATCTCGTTCAGGCAGAAGCGCGAGATTCCG
CGAGACCGGCCTTTCGGATCCTGGCGACCAACGAACGGAGAGGGTCGGAC
CGCGTGTCGTACACGGCCGGGGCGCAGGTCGAGATCTACCAGCATGTCAT
AACGTTGGGACTAGGCCGAGTGGTGACGCTTAACGGCGTCCAGGTCACCC
TTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCTCAGCGGTAGGAAC
GTTGTCCTCCGGACGGATTTTGACCTGAGGGTGGCTTACAACGGAAACCA
CCGTCTGGAGGTCAGCGTCCCACCGGCATACACCGATAACATCCAAGGCC
TGTGCGGAAACTTCAACAATGATCCACAGGACGACTTGCAAAAGCCGGAT
GGCACCACGGCCTCAAGCCACACTGAGTTTGGAAACAGTTGGGAGGTTGA
TGCCGACGACAGGTATATGGTGATCAACAAATTACCGCTGGTTCTCTTCT
TGCTTGCAGCGACGTTCGATTCCGGAAGTGCACAATGCGATGAGACACTA
CGGTCCCCGGCAGGCGTGATATCCTCGCCGGGGTACCCAGGCGACTACCC
GCCGAGAGTAGACTACACGTGGTGCGTCGATGTGGAGGGAGCTACAGGCA
TAGATGTCACTTTTGTGGGTGAATTCCACTTGGAAATCAACGAGGACAAT
GACGGAACAGAATCATGCAAAGATTCTGTGGAGATAGGATCGGGAAACGT
CCCGTTCCAGGACTCCATCGAAGTCTTCTGTGGAAACAGCACCCCGCCGG
CACAGAGGGTGGACACCAAGCAGATGTGGGTGAACCTGTACACAGACAGG
AACGTGGAGATGTCAGGGTTCCGACTGGTATACAGATCAGACCTGGACGT
ATGCTACAGTTCTCCCTGTACTAACGGAGGCACGTGCGTTTCCGACCTGA
CAACCTACACATACACCTGTCAATGTCCACCTGGATGGCAAGGAACTAAT
TGTGAACAAGATGTGGATGAGTGTGCCAGCGATCCTTGTCAAAATGGCGG
CGTGTGTTCACACGAAGTCGGAGTTGATTTCTACCAATGTACCTGTGAAC
CAGGTTTCACTGGAGTCAACTGTGAAATAGATATCGACGAGTGTGAAAAC
GTTACCTGTCAGAACCAGGGCAGCTGTGTGGACTTGGTCAACGACTTCTT
TTGCAACTGCACCGCAGGATGGGAGGGACGATTCTGTGAAAACGAGACGA
ATGAGTGCGAGAGTGACCCGTGTCTCAACAACGGAACGTGCATAGACCTC
TTCAACAATTACACCTGCGCATGCACAGAAGAATGGATCGGAGACAACTG
TCAACTCCGTAACGGCACCACTCCCTGTGAGTCTAATCCCTGTCTGAACG
GAGGGAACTGTACAGAAGCTAACGATGACTACATGTGTGTGTGCCCGCCG
ATCTACACAGGAGTCAACTGTGAAGAGATCCTTGGACCTTCAGCGGTATG
TGTCAGCTGGGGAGATCCACACTACATCACGTTCGACGGCACAAGCGTGA
ACTTCCAGGGCGCGTGCACGTACAATCTCGTTCAGGCAGAAGCGCGAGAT
TCCGCGAGACCGGCCTTTCGGATCCTGGCGACCAACGAACGGAGAGGGTC
GGACCGCGTGTCGTACACGGCCGGGGCGCAGGTCGAGATCTACCAGCATG
TCATAACGTTGGGACTAGGCCGAGTGGTGACGCTTAACGGCGTCCAGGTC
ACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCTCAGCGGTAG
GAACGTTGTCCTCCGGACGGATTTTGACCTGAGGGTGGCTTACAACGGAA
ACCACCGTCTGGAGGTCAGCGTCCCACCGGCATACACCGATAACATCCAA
GGCCTGTGCGGAAACTTCAACAATGATCCACAGGACGACTTGCAAAAGCC
GGATGGCACCACGGCCTCAAGCCACACTGAGTTTGGAAACAGTTGGGAGG
TTGATGCCGACGACAGGTATATGGTGATCAACAAATTACCGCTGGTTCTC
TTCTTGCTTGCAGCGACGTTCGATTCCGGAAGTGCACAATGCGATGAGAC
ACTACGGTCCCCGGCAGGCGTGATATCCTCGCCGGGGTACCCAGGCGACT
ACCCGCCGAGAGTAGACTACACGTGGTGCGTCGATGTGGAGGGAGCTACA
GGCATAGATGTCACTTTTGTGGGTGAATTCCACTTGGAAATCAACGAGGA
CAATGACGGAACAGAATCATGCAAAGATTCTGTGGAGATAGGATCGGGAA
ACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTGTGGAAACAGCACCCCG
CCGGCACAGAGGGTGGACACCAAGCAGATGTGGGTGAACCTGTACACAGA
CAGGAACGTGGAGATGTCAGGGTTCCGACTGGTATACAGATCAGACCTGG
ACGTATGCTACAGTTCTCCCTGTACTAACGGAGGCACGTGCGTTTCCGAC
CTGACAACCTACACATACACCTGTCAATGTCCACCTGGATGGCAAGGAAC
TAATTGTGAACAAGATGTGGATGAGTGTGCCAGCGATCCTTGTCAAAATG
GCGGCGTGTGTTCACACGAAGTCGGAGTTGATTTCTACCAATGTACCTGT
GAACCAGGTTTCACTGGAGTCAACTGTGAAATAGATATCGACGAGTGTGA
AAACGTTACCTGTCAGAACCAGGGCAGCTGTGTGGACTTGGTCAACGACT
TCTTTTGCAACTGCACCGCAGGATGGGAGGGACGATTCTGTGAAAACGAG
ACGAATGAGTGCGAGAGTGACCCGTGTCTCAACAACGGAACGTGCATAGA
CCTCTTCAACAATTACACCTGCGCATGCACAGAAGAATGGATCGGAGACA
ACTGTCAACTCCGTAACGGCACCACTCCCTGTGAGTCTAATCCCTGTCTG
AACGGAGGGAACTGTACAGAAGCTAACGATGACTACATGTGTGTGTGCCC
GCCGATCTACACAGGAGTCAACTGTGAAGAGATCCTTGGACCTTCAGCGG
TATGTGTCAGCTGGGGAGATCCACACTACATCACGTTCGACGGCACAAGC
GTGAACTTCCAGGGCGCGTGCACGTACAATCTCGTTCAGGCAGAAGCGCG
AGATTCCGCGAGACCGGCCTTTCGGATCCTGGCGACCAACGAACGGAGAG
GGTCGGACCGCGTGTCGTACACGGCCGGGGCGCAGGTCGAGATCTACCAG
CATGTCATAACGTTGGGACTAGGCCGAGTGGTGACGCTTAACGGCGTCCA
GGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCTCAGCG
GTAGGAACGTTGTCCTCCGGACGGATTTTGACCTGAGGGTGGCTTACAAC
GGAAACCACCGTCTGGAGGTCAGCGTCCCACCGGCATACACCGATAACAT
CCAAGGCCTGTGCGGAAACTTCAACAATGATCCACAGGACGACTTGCAAA
AGCCGGATGGCACCACGGCCTCAAGCCACACTGAGTTTGGAAACAGTTGG
GAGGTTGATGCCGACGACAGGTATATGGTGATCAACAAATTACCGCTGGT
TCTCTTCTTGCTTGCAGCGACGTTCGATTCCGGAAGTGCACAATGCGATG
AGACACTACGGTCCCCGGCAGGCGTGATATCCTCGCCGGGGTACCCAGGC
GACTACCCGCCGAGAGTAGACTACACGTGGTGCGTCGATGTGGAGGGAGC
TACAGGCATAGATGTCACTTTTGTGGGTGAATTCCACTTGGAAATCAACG
AGGACAATGACGGAACAGAATCATGCAAAGATTCTGTGGAGATAGGATCG
GGAAACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTGTGGAAACAGCAC
CCCGCCGGCACAGAGGGTGGACACCAAGCAGATGTGGGTGAACCTGTACA
CAGACAGGAACGTGGAGATGTCAGGGTTCCGACTGGTATACAGATCAGAC
CTGGACGTATGCTACAGTTCTCCCTGTACTAACGGAGGCACGTGCGTTTC
CGACCTGACAACCTACACATACACCTGTCAATGTCCACCTGGATGGCAAG
GAACTAATTGTGAACAAGATGTGGATGAGTGTGCCAGCGATCCTTGTCAA
AATGGCGGCGTGTGTTCACACGAAGTCGGAGTTGATTTCTACCAATGTAC
CTGTGAACCAGGTTTCACTGGAGTCAACTGTGAAATAGATATCGACGAGT
GTGAAAACGTTACCTGTCAGAACCAGGGCAGCTGTGTGGACTTGGTCAAC
GACTTCTTTTGCAACTGCACCGCAGGATGGGAGGGACGATTCTGTGAAAA
CGAGACGAATGAGTGCGAGAGTGACCCGTGTCTCAACAACGGAACGTGCA
TAGACCTCTTCAACAATTACACCTGCGCATGCACAGAAGAATGGATCGGA
GACAACTGTCAACTCCGTAACGGCACCACTCCCTGTGAGTCTAATCCCTG
TCTGAACGGAGGGAACTGTACAGAAGCTAACGATGACTACATGTGTGTGT
GCCCGCCGATCTACACAGGAGTCAACTGTGAAGAGATCCTTGGACCTTCA
GCGGTATGTGTCAGCTGGGGAGATCCACACTACATCACGTTCGACGGCAC
AAGCGTGAACTTCCAGGGCGCGTGCACGTACAATCTCGTTCAGGCAGAAG
CGCGAGATTCCGCGAGACCGGCCTTTCGGATCCTGGCGACCAACGAACGG
AGAGGGTCGGACCGCGTGTCGTACACGGCCGGGGCGCAGGTCGAGATCTA
CCAGCATGTCATAACGTTGGGACTAGGCCGAGTGGTGACGCTTAACGGCG
TCCAGGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCGCCTC
AGCGGTAGGAACGTTGTCCTCCGGACGGATTTTGACCTGAGGGTGGCTTA
CAACGGAAACCACCGTCTGGAGGTCAGCGTCCCACCGGCATACACCGATA
ACATCCAAGGCCTGTGCGGAAACTTCAACAATGATCCACAGGACGACTTG
CAAAAGCCGGATGGCACCACGGCCTCAAGCCACACTGAGTTTGGAAACAG
TTGGGAGGTTGATGCCGACGACAGGTATATGGTGATCAACAAATTACCGC
TGGTTCTCTTCTTGCTTGCAGCGACGTTCGATTCCGGAAGTGCACAATGC
GATGAGACACTACGGTCCCCGGCAGGCGTGATATCCTCGCCGGGGTACCC
AGGCGACTACCCGCCGAGAGTAGACTACACGTGGTGCGTCGATGTGGAGG
GAGCTACAGGCATAGATGTCACTTTTGTGGGTGAATTCCACTTGGAAATC
AACGAGGACAATGACGGAACAGAATCATGCAAAGATTCTGTGGAGATAGG
ATCGGGAAACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTGTGGAAACA
GCACCCCGCCGGCACAGAGGGTGGACACCAAGCAGATGTGGGTGAACCTG
TACACAGACAGGAACGTGGAGATGTCAGGGTTCCGACTGGTATACAGATC
AGACCTGGACGTATGCTACAGTTCTCCCTGTACTAACGGAGGCACGTGCG
TTTCCGACCTGACAACCTACACATACACCTGTCAATGTCCACCTGGATGG
CAAGGAACTAATTGTGAACAAGATGTGGATGAGTGTGCCAGCGATCCTTG
TCAAAATGGCGGCGTGTGTTCACACGAAGTCGGAGTTGATTTCTACCAAT
GTACCTGTGAACCAGGTTTCACTGGAGTCAACTGTGAAATAGATATCGAC
GAGTGTGAAAACGTTACCTGTCAGAACCAGGGCAGCTGTGTGGACTTGGT
CAACGACTTCTTTTGCAACTGCACCGCAGGATGGGAGGGACGATTCTGTG
AAAACGAGACGAATGAGTGCGAGAGTGACCCGTGTCTCAACAACGGAACG
TGCATAGACCTCTTCAACAATTACACCTGCGCATGCACAGAAGAATGGAT
CGGAGACAACTGTCAACTCCGTAACGGCACCACTCCCTGTGAGTCTAATC
CCTGTCTGAACGGAGGGAACTGTACAGAAGCTAACGATGACTACATGTGT
GTGTGCCCGCCGATCTACACAGGAGTCAACTGTGAAGAGATCCTTGGACC
TTCAGCGGTATGTGTCAGCTGGGGAGATCCACACTACATCACGTTCGACG
GCACAAGCGTGAACTTCCAGGGCGCGTGCACGTACAATCTCGTTCAGGCA
GAAGCGCGAGATTCCGCGAGACCGGCCTTTCGGATCCTGGCGACCAACGA
ACGGAGAGGGTCGGACCGCGTGTCGTACACGGCCGGGGCGCAGGTCGAGA
TCTACCAGCATGTCATAACGTTGGGACTAGGCCGAGTGGTGACGCTTAAC
GGCGTCCAGGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCGTGCG
CCTCAGCGGTAGGAACGTTGTCCTCCGGACGGATTTTGACCTGAGGGTGG
CTTACAACGGAAACCACCGTCTGGAGGTCAGCGTCCCACCGGCATACACC
GATAACATCCAAGGCCTGTGCGGAAACTTCAACAATGATCCACAGGACGA
CTTGCAAAAGCCGGATGGCACCACGGCCTCAAGCCACACTGAGTTTGGAA
ACAGTTGGGAGGTTGATGCCGACGACAGGTATATGGTGATCAACAAATTA
CCGCTGGTTCTCTTCTTGCTTGCAGCGACGTTCGATTCCGGAAGTGCACA
ATGCGATGAGACACTACGGTCCCCGGCAGGCGTGATATCCTCGCCGGGGT
ACCCAGGCGACTACCCGCCGAGAGTAGACTACACGTGGTGCGTCGATGTG
GAGGGAGCTACAGGCATAGATGTCACTTTTGTGGGTGAATTCCACTTGGA
AATCAACGAGGACAATGACGGAACAGAATCATGCAAAGATTCTGTGGAGA
TAGGATCGGGAAACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTGTGGA
AACAGCACCCCGCCGGCACAGAGGGTGGACACCAAGCAGATGTGGGTGAA
CCTGTACACAGACAGGAACGTGGAGATGTCAGGGTTCCGACTGGTATACA
GATCAGACCTGGACGTATGCTACAGTTCTCCCTGTACTAACGGAGGCACG
TGCGTTTCCGACCTGACAACCTACACATACACCTGTCAATGTCCACCTGG
ATGGCAAGGAACTAATTGTGAACAAGATGTGGATGAGTGTGCCAGCGATC
CTTGTCAAAATGGCGGCGTGTGTTCACACGAAGTCGGAGTTGATTTCTAC
CAATGTACCTGTGAACCAGGTTTCACTGGAGTCAACTGTGAAATAGATAT
CGACGAGTGTGAAAACGTTACCTGTCAGAACCAGGGCAGCTGTGTGGACT
TGGTCAACGACTTCTTTTGCAACTGCACCGCAGGATGGGAGGGACGATTC
TGTGAAAACGAGACGAATGAGTGCGAGAGTGACCCGTGTCTCAACAACGG
AACGTGCATAGACCTCTTCAACAATTACACCTGCGCATGCACAGAAGAAT
GGATCGGAGACAACTGTCAACTCCGTAACGGCACCACTCCCTGTGAGTCT
AATCCCTGTCTGAACGGAGGGAACTGTACAGAAGCTAACGATGACTACAT
GTGTGTGTGCCCGCCGATCTACACAGGAGTCAACTGTGAAGAGATCCTTG
GACCTTCAGCGGTATGTGTCAGCTGGGGAGATCCACACTACATCACGTTC
GACGGCACAAGCGTGAACTTCCAGGGCGCGTGCACGTACAATCTCGTTCA
GGCAGAAGCGCGAGATTCCGCGAGACCGGCCTTTCGGATCCTGGCGACCA
ACGAACGGAGAGGGTCGGACCGCGTGTCGTACACGGCCGGGGCGCAGGTC
GAGATCTACCAGCATGTCATAACGTTGGGACTAGGCCGAGTGGTGACGCT
TAACGGCGTCCAGGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTCAGCG
TGCGCCTCAGCGGTAGGAACGTTGTCCTCCGGACGGATTTTGACCTGAGG
GTGGCTTACAACGGAAACCACCGTCTGGAGGTCAGCGTCCCACCGGCATA
CACCGATAACATCCAAGGCCTGTGCGGAAACTTCAACAATGATCCACAGG
ACGACTTGCAAAAGCCGGATGGCACCACGGCCTCAAGCCACACTGAGTTT
GGAAACAGTTGGGAGGTTGATGCCGACGACAGGTATATGGTGATCAACAA
ATTACCGCTGGTTCTCTTCTTGCTTGCAGCGACGTTCGATTCCGGAAGTG
CACAATGCGATGAGACACTACGGTCCCCGGCAGGCGTGATATCCTCGCCG
GGGTACCCAGGCGACTACCCGCCGAGAGTAGACTACACGTGGTGCGTCGA
TGTGGAGGGAGCTACAGGCATAGATGTCACTTTTGTGGGTGAATTCCACT
TGGAAATCAACGAGGACAATGACGGAACAGAATCATGCAAAGATTCTGTG
GAGATAGGATCGGGAAACGTCCCGTTCCAGGACTCCATCGAAGTCTTCTG
TGGAAACAGCACCCCGCCGGCACAGAGGGTGGACACCAAGCAGATGTGGG
TGAACCTGTACACAGACAGGAACGTGGAGATGTCAGGGTTCCGACTGGTA
TACAGATCAGACCTGGACGTATGCTACAGTTCTCCCTGTACTAACGGAGG
CACGTGCGTTTCCGACCTGACAACCTACACATACACCTGTCAATGTCCAC
CTGGATGGCAAGGAACTAATTGTGAACAAGATGTGGATGAGTGTGCCAGC
GATCCTTGTCAAAATGGCGGCGTGTGTTCACACGAAGTCGGAGTTGATTT
CTACCAATGTACCTGTGAACCAGGTTTCACTGGAGTCAACTGTGAAATAG
ATATCGACGAGTGTGAAAACGTTACCTGTCAGAACCAGGGCAGCTGTGTG
GACTTGGTCAACGACTTCTTTTGCAACTGCACCGCAGGATGGGAGGGACG
ATTCTGTGAAAACGAGACGAATGAGTGCGAGAGTGACCCGTGTCTCAACA
ACGGAACGTGCATAGACCTCTTCAACAATTACACCTGCGCATGCACAGAA
GAATGGATCGGAGACAACTGTCAACTCCGTAACGGCACCACTCCCTGTGA
GTCTAATCCCTGTCTGAACGGAGGGAACTGTACAGAAGCTAACGATGACT
ACATGTGTGTGTGCCCGCCGATCTACACAGGAGTCAACTGTGAAGAGATC
CTTGGACCTTCAGCGGTATGTGTCAGCTGGGGAGATCCACACTACATCAC
GTTCGACGGCACAAGCGTGAACTTCCAGGGCGCGTGCACGTACAATCTCG
TTCAGGCAGAAGCGCGAGATTCCGCGAGACCGGCCTTTCGGATCCTGGCG
ACCAACGAACGGAGAGGGTCGGACCGCGTGTCGTACACGGCCGGGGCGCA
GGTCGAGATCTACCAGCATGTCATAACGTTGGGACTAGGCCGAGTGGTGA
CGCTTAACGGCGTCCAGGTCACCCTTCCGCTCCAACTAGCGGAGGGCGTC
AGCGTGCGCCTCAGCGGTAGGAACGTTGTCCTCCGGACGGATTTTGACCT
GAGGGTGGCTTACAACGGAAACCACCGTCTGGAGGTCAGCGTCCCACCGG
CATACACCGATAACATCCAAGGCCTGTGCGGAAACTTCAACAATGATCCA
CAGGACGACTTGCAAAAGCCGGATGGCACCACGGCCTCAAGCCACACTGA
GTTTGGAAACAGTTGGGAGGTTGATGCCGACGACAGGTAT
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97418gene:BL97418Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97418_cuf5transcript:BL97418_cuf5-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97418_cuf5-E1BL97418_cuf5-E1-1564476830-312220Branchiostoma lanceolatumexon
BL97418_cuf5-E2BL97418_cuf5-E2-1564476830-312217Branchiostoma lanceolatumexon
BL97418_cuf5-E3BL97418_cuf5-E3-1564476830-312215Branchiostoma lanceolatumexon
BL97418_cuf5-E4BL97418_cuf5-E4-1564476830-312213Branchiostoma lanceolatumexon
BL97418_cuf5-E5BL97418_cuf5-E5-1564476830-312211Branchiostoma lanceolatumexon
BL97418_cuf5-E6BL97418_cuf5-E6-1564476830-312209Branchiostoma lanceolatumexon
BL97418_cuf5-E7BL97418_cuf5-E7-1564476830-312207Branchiostoma lanceolatumexon
BL97418_cuf5-E8BL97418_cuf5-E8-1564476830-312205Branchiostoma lanceolatumexon
BL97418_cuf5-E9BL97418_cuf5-E9-1564476830-312203Branchiostoma lanceolatumexon
BL97418_cuf5-E10BL97418_cuf5-E10-1564476830-312201Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000110genomeSc0000110:5854..22383 -
Properties
Property NameValue
Transcript idBL97418_cuf5
Biotypeprotein_coding