Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97387_cuf5 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97387_cuf5
Unique Nametranscript:BL97387_cuf5
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97387_cuf5

>transcript:BL97387_cuf5-protein ID=transcript:BL97387_cuf5-protein|Name=transcript:BL97387_cuf5|organism=Branchiostoma lanceolatum|type=polypeptide|length=1736bp
SAGLVNLNVTIMQRIIKPLMEVPARRRRHDTETKTTDNHIKSDTDNPLKR
IKRQELNNPQVQEEIIHQRVYRNVLAIVPNGYEVSANITIEPVDVIPGNM
LLIKVAEEGPDKPTVCQLRDVGAFAEFQLRAYSLQPCDDDYDYYDDYDYE
GFGPTMGPTELPVQEGNVTTCQQRYNDWIVARKAVPDGNRCVGADFVTRH
YSTCFVPPEVIIGPSEAEVIVGETVTITCDATGFPSDYNYLWTVDGTVVP
NQRDAVFRYEGINGVHKVKCRVTSSGGEMESEDSTVTVVPEGTVLCRDVQ
SLFTSMQGLCVREEVTFGTRATADGTYTSIVPYQKGFLSAMIDVQATSVT
VDWNQFPVYHSSLREAGEGTLNARVTYDNLDGQSFSSTATGQVTAETSGP
VDLLFPRQVVVQQGQNVNITLHLQLSDSDSTPVVNPNCSSCVGLKLWTYQ
GNCDFSLEFPESNGRCLRAFQAWWTKLAERGGAGSCQDYYLDQPFLDKYR
KCFVRPTLQYITSPVKALYRQPARLACIASGGPPPSVRWLRNNKPVNISD
SNTIVFASVTPANTGNYTCVIEEREFFNQTLTATASLELQGLACTKLRQT
ENRLLGECASDAGFGYLESEFESCWPSFIAQQNTSIYQLQLQLFVEGQSL
PWIRSNEATGAVNLNVTILWLGKQTLRPLRRRDVRSRIVDRQSSADRIKR
AEPEQPVSLHQKIYRNVLVLTEEPPTLNVTIEPVNVTMNDIIQVNITEEG
SNTTLCQIGIYPEIQLMGYIFAPCNRNIIPNDFSESLQGQEESLSVCQQR
YSEWLVARKAVPDGDSCVGPDLVTSQYQKCFVPPEVSIRPSEVQDLVIGE
TVTITCDATGFPSDYNYQWTVDGTVVPNQRGAVFRYDAVSGVHKVKCKVT
SSSGEMESEDSTVTVLPEGTMTFVSSIRITARSFTPEMTDPNSAAFQNIS
TEIKDWYQQAVGSVQGQVSIRVKDAKPGSVIATQNINVQDSVLQDKDLYN
GISNALKTAAQSPSSLGVDPNSVTLLSASTCYGETVTVTDSSSNRVTLTF
PSSAGDTHAYSTQRCANNTESAGIPRAVRRCIGSFETGVSWTSPELLDCG
LDLSKLAQMPVTEGNVAEVAADLQILTSIGGSLTIGNIRDASTVLGNIAN
TTGDENVGYSVVVSVDQIMNIEDDILYQSQVMDQAPSRIVQALEQFNDRV
NLTSNRFRRIEQNIGVETYQIGAAELINSVGFASLEGSEDLEDGLVRSYS
DSSFIPNDQVDASIALPGELGSVVAFLKENIPDPTDVEVRLSFIIYQSSR
LFQSNQTAPSSADTKTRVNSRVIASRVTGFELKNLPNPVVTRYLPIVENS
TNSTVSNIRCVSWDFNAGGGGGAWSTEGCDFVGIDNNRVVCECNHLTNFA
VLMDIYGGLHSFALDLISKIGIALSITGLVLTLITYLVFKQLRQTRPQHL
LINLCLALLATLIIFLAGINATSSPVGCTVVAFLLHYFLLAVFMWMAIEA
FNMYLAFVKVLGAHVSRFLLKAAILAWGLPFVIAIITLVVDVPSTYPDGQ
ETYRSTSFCWLQGNQLYFGFLLPAGLVLLFNTIVYIMVISKLTCRGRTKG
RVADPGKGATKQQLRIAIAVMVLVGLTWIFGFFMISDGRIVFSYLFCIFN
SLQGFFIFIFQCVRQKEVQNLWFKVLLTFRCCGCPADMYRTTKSSGGKSS
SNQTESTAEGYSRGHRKSSTPETVPNAYTNIPMNSI
Run BLAST on NCBI

mRNA from alignment at Sc0000034:1201381..1221080-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97387_cuf5 ID=transcript:BL97387_cuf5|Name=transcript:BL97387_cuf5|organism=Branchiostoma lanceolatum|type=mRNA|length=19700bp|location=Sequence derived from alignment at Sc0000034:1201381..1221080- (Branchiostoma lanceolatum)
ATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCA AACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACA AAAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACG TATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCC ACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAA GTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACAT GTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCC AATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGT TTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATGA AGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAA ATGTGACAACTTGTCAGCAAAGGTGCCTTTTTTCTTATCAAAATATAGTA TATAGTATTTTTTTGTAATTCCTTTTTCTTTGTCTATGGAAGAGAATTAT AGATCTATGGAAGATTGTTTTAAGCTTTAATTAGCTTTAAGAATAGAGAG CAAAGAAATGGAAGAGACTGCAGTTGTTTGTGGGCAAGCATGACATAAAG ACATTTACAGCAAGTTGTTCTGCTTTGAATAGAAGCCAGGGTTGATTTGA TGGTAATAATGGTGACATAAATATCCTTGCAGGTACAATGACTGGATAGT TGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTG TCACCCGACATTACTCCACATGTTTTGGTAAGGGACCTGAGTTTTACAAA GTTGTCAATGATTTCTATTCAAGGATATTTAGAAACTAGGCAAGAATAAC CTATAGTATAAGAAATTAAAATATCTTAGAAATATTCAATTGGCAGCTTT GGAGCAAAGTTTGATAACCACTCTGAGCATATCTTTTTTTTTTCCATATA GTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGG GGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATA ACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCT GTCTTCAGGTTGGTACTAGAAATCAATGACTCTGAGTCTATTTCCAGAAC TCAGATTGATAGTAAAGGATACTTAATAATAAGTACATATCTATGCATAC AGATCCTGAGCTAAATTACTCTTAGCCTATTGTTGCATTTGAGTGTTGGA ATATCTTAAGAAACAGAATGTTACTTGATATTAACATCCGTCTGCAGGTA TGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAG GTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGT TTGCACTTCAATTGCTTTGATTTGCTATCATTGCTGAAGTGGTCGCACGT TTAATATGAGTTGGCTTGCAGGTGTGTCTGTAAAGAGGAACATTTGTATA CAAAGTTATCATCAAAGTATAGAAATGCAGTGTAGACTGCAAAATCATTT GTAGCCACACACAAAGTGAAACTAGTCTGGGTGTGGGCTTGAATAAAGTT CTAAATGGGAACTATGCAGCTACAGCGTCCTTTCGGAAGATGTAGCATGT GTACAGTTGACTTGAGGGTGTCCACTACTATTTGCCCATCATTTGTAGCA TTGTTATGTTGGAGTGTGCTTATTGTATGTACAGTAACATGTAGGTCTAC TTGACAAATGCCCTACCCAGTTTTTATGATTGACAGCTTGACTCATTAAC CTCTGAGCTGATAATGCTGATAATAGGCTTCATAAAAGCAACAAATACAA CTACCATATAATCTCTTCAATGGGAGAGGCCATGCTTTATCAATGACTAA TCAAGACTTCATACTTCAAAGGCAAGTCTAAACTGTTTACATTTCAGCTT CATTTTATGGTCTTCCTGGGGGACAAAAATGGTAATAAACACTCAATAAA ACACTTTATTTATTTGCACAAGCTAAGAAACAGTGGCCAGGCAGCCAATT AGATTAGACAAGTCGTTTTGTCTTCTCTCTGCCCACGCTATTTGTCAACC ACTTGCCCCCACACCCTGAGTAACACCCATAAAAGTGATCTAGCTGTGAC AACTCTAAAGCCTTAGTGTAAATCAGGTCTTAGTCATTTCATGGTTACTA CCCTTGAGTACACTTGGTTCCCCCGCTGCTCTGGAAGTTGCCTGATCATG AAAATGGTCAGGTCTTGCCTGCATGTATTTTCTGCATTTGGGCCAACAGG GGCATTGATATTGCTCTGTTTGGGAGTACAAGAGATTGTCTGTGGACAAT CACCGGCCAACAATGCAAAAAGGGAAAGGAGTGAGCAGTCATCCAGTAAG TAATTGGACTTGGACTTTGGGATTTTTTCTAGTATACCCTCTGAAATGCT ATTGCAATGTACTGTAAATGCATGGTTTACATGGTTTTTACTTTGCGCCA AGGCAAAAATAGAGTGTTCGCGGCAGTTTTAAGTTCGCTGCAGCGCTATA TATATATAGTGACATACTGCTACAGTATATTGGACAAAAATGTTAGCGGT GGTTTTAAGTTCACGGTGAAACGGTCGCCGCGAAAACCATGAACATAAAC CACCGCGAACATTTCTGCATCATACAGTTTTTCAGTATATTACATGACTA TTGTAAGATGCAAATTTCAAAGGGCTTCATCCTGATATTCTACTGAACTA CATGTATTGACTACATTTTTTGGGGAGAATGGCAGAGAGCTTTTATCTGG TATCTGCCATGTGTTTTAAGTTCTTGCTGTTTCTTCATAGGAACTGTACT ATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCA GAGAAGAGGTGACATTTGGGACAAGAGTGAGTAAAAAAATATAACTTTTA AAGTTTCATTTTAAGTTGTCATTTTGTTTTGTGTTTGTAATGGTACTCGA TATGGTGAATTGGAAGACTTTGATTTGGCCTCCTGTCAAACAGTAACATC TTAAAGCAATAGATTTAGATGTAAAAAAAAAAGTAATACATCCAATGACA GTAAGTAACTTTGACTACACCCCATCAAGACAAAGTGAATTACACTGAAA GGTATATTTCAGGCTCCTGTGCCAATGTGAAAAGTTTAATAATACATGTA ATAAGCCTACGAAATGTTATAAAAAAAATTTGATATGTGATTTTGTAAGG ACTAAACAATTTTGACTGAATCTTTTTAGATATGAATTAAATGCAGTTTC ATTGTGTTTTTTCCAGGCTACAGCTGATGGCACTTATACTTCTATTGTGC CTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCG GTATGTTAAAAAGAGATCATCTGTGTGCTATGATATTTTCTAAATCCTGG TTTGATACAGTTTTGGTCTGGTCTGCGATGTACTAGCTAAGGGTAGTTAC ATGTAACAAGCCATCTTCATTGAATTCTACATTCATTTTATATTTACCTG GCATTAGTAACATGATTTGTGCCAAAATTGAAGAAATGATTACATTTCTG ACACACATTTTCCCAGAATTGTCCAAAGTCGTATTATAATTGCTTCTACT CATATTCTGTGTGATGTGATCAATTTACGGTAATAGGACAGGAGATGCTT CAAAAATGTAATATTTCTTCTTTCTATACTTTTTTCTTTTTAAGGTGACA GTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGG AGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAAT CTTTCAGCTCAACTGCCACTGGGCAGGTAAAATAAAACTTTAATGCTCCT GGTGTATTCTAAAGATTATAAACAATCATTTGGAGATACTGTATAATTGA CAAGAATAAGAACACATAGAAAATCCTTTAATGAAATGTCAATAAGAAAT TAAAGAAGTTAACCTTTATAAATCCTCAAAGATTGTTATGATCCAAGGTT TCGACTTGTCAGTAGAATGAAAATGTGTGGTTGAATCAGCATTAATGTTA CTGTCTTTTGATATGTTTTCTGGAAAATTAGAATGATATTTTTCACTAAG TTGATATTTGACTATTGTACTTTACTTTTCAGGTAACTGCTGAGACTAGT GGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACA GAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACAC CAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGGTA GGTTGTTACAAAATGTACTGCACATTTGGTGGTCCTTCACTCTGAAATAT TCAGTTCCATTTTACTACTTAGCAACAGGTGCACAGCATGATCAATTGTG ACCAACTTGTCAATTGTGTACAAAATGTCATAGGAATAGCAAGAAAATGT TTATGTTAAAAGGACTTACAGGTGCTTCTTAAATCTGTCAGAATACATAC ATTAATTTTTTGTAGCCAGTAAAAGTAATTCATATAACTGTAGCAAGAGG GGTCAAATTCAGAAAATTTGCTTCTAAGTTGACTTCCGTAAAATTCCTAT TTACGTACGCACCCCTCCTAATTATAACGTACGCACCCCCGATTTGGGGA CGATTGCGGGCCTGACTCAGTGAGTTGAAACGTTCAGGGGAAAAACCCTC CTAACGTACGCACCCCCTCTCCAGCATTTCGGTGGATAGTTAAGAGGTTG ATATGATCATCCTTCCGATGATGTTTACCGACTTAAAGGGTTACTGAGAA AATGTTTCTGGGTAGAAAATATCAAACAATTTAAATATATGTATTATTTA TTCTTCATTACTGATTGATTGTGTGGTAGCATTCCACACACTTCATTTGC ATGAAGATGTACCATACTCTCATGCTGATATGTGATTTTTCCGAGGAAGA ACCCCTCCTAACGTACGCACCCCGACTTTGGTGTCGGCCTGGAGCACCTG CTTGCAACTTGAAAAGTTAAATATGGATTTTACGGTACATTGAGTCTTTA TACCACAATGTACAGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTT CCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAA AACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGAC CAGCCGTTTCTTGATAAATACCGTAAATGCTTTGGTAAGTTTGTCCTTAG TTGTCCAGGTTACTAATTTTCAATATTGAAGGTATGAATATACCGGTATA TTTAGTACCGTAATAATAGCCTAAAGTTTAACTGGCTTTCAGTATCCACA GTTTTAAATTGTTTATGAATAACCTTCTCACAGCAAAGAATAGAAAAGCA GAGAAAGCACCCAGTGATGATCATTTTCAACTTCTCTAAGTCTAAGTTCT AATGCAAACTTTCATACCTGATTTTCACAACTTTGACATTTACAAGCAGA ATGATACATATTGATAAGAGGAAACAATGCTGACCTGAATAGTATACAAC TCTCTCAACAAGCTCTCCTATGTGTAACCATTCATTCAACTAACATTTAA CATGTTTATGAGAACAGTCACTTAAAAATCATTCTTCATTGCTGCTTTGC AACGAATTTAAAAAAACGGAAACTTGTAAATTGTGAATTCTGTTAAATCT TTCTTGAGTGTCTTTAAAATTGACAATTGTTTTTTTCCCACCAGTTCGGC CTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCT GCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTG GTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGT TTGCCTCTGTCACTCCAGCCAATACTGGAAAGTAAGTGGGAGAACCAGTT AATTATTCATTATCATTGATGTGATTTTTAGGAATACACATAACATTTTC CCTTTCATTAAAACCATGGAATGTATCAATTTTAAAATGTGACTTATGCA AATTGGGATTTCATATTGTAGACTCCAAAAACTTTTGATCAAATGCAAAG CATCATATGATATCAAATGACCAAACTGATAGGTTGGTAATAGGCACAAT TGCCTACATACTCTCATCACTTTTAACATGTCCAAAGTTTGTCTCTCCTC AAACCTGAGCTCCTTAATTACTACCAGAAGTGTGCAAATTATATATATAC ATAATTATAATCAACCCAATTGTCTAAATAAGATATGTTAATCATAAGTT GGATTGCTATACCAATCTTAAGCTATGGCATGAGCTAAGATATCATATAA ATGTAAGTACAAATGTCAAGGGTTTGTATGATAACCTTACAATTGCTGCA AGTTCAATAATCTTTCCAAAAGTAAAGTGTGCCTTTTTATCGATAATCAT GATGATTGTTTCAACAGTTATACCTGTGTTATTGAAGAGAGAGAGTTCTT TAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGTAAGTTTT ATAATGTTCTAGAAACATCTCTGAAAGTTAGATAATATTTGTAACATTTC AAGTTCAACAAAACCTTAGTTGAACTGGGATGGGGGACAGTACCAATCAT ACTTAAATTGACCAACTTTTGTAAGTTGCAATATTATGCTGAGCTGTCTG GTCACATCTTTAAAAAATGATTTTGCAATTTTGCACTAAAACAGAACGCA TGTTACCTCTGCAGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACC GGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCT GAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCAT CTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGA TACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTG TGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTC AAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAAC CTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTA CTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGT AACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACA CTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATAC ATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTC CCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTAAAATC TTCTACAATATCTTTTGATTAAAATGACAAATTGAACCACAACTGTCATT TTCCCAGAGCTAAGAATGAACCACAACTCCTTGTTACCATAGAAGAAGAA CTTTATTGCACAACAATTGTAACTGGTACAATGTATGGCAACTTGAGAGT TGAACTATTGCTATGATTAGAAAGGCAAGAATTGAGTGTTATCGTCAGAA TGATGAAAGTTGATGTCATGTTTTGCATTACTGCAGGTATTCTGAATGGC TTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGAC CTGGTGACTAGTCAGTACCAGAAATGTTTCGGTGAGTAAATCAAGGTTAC TACTGCCGAGGAAATAACTGTTGTATACATTCAAAGTGCTCAATAACCTT TAGTCTTGTTCAGACTTGTTTGCTGTTCAAATTTGTGGGGGAAAGTGTCT TCTTGAATGTGTTCACCAAATTTGAAAGTTTCGAAATTGGAGTTTATCTA AACTTGACGATCACATGATTACTTGATGATCATCATCACTGTTAGATACA GAACAAATTTATACAATGTATTACATATCATAATGAATACAAAAAGTTGT ATGCACCGTGCTCTCATTAGCTTCTTTATTTGTTTGTTAATCAAGTTCCC CCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGA GACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACT ACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTC TTCAGGTTGGTGTATAAATGGTTCAATAGCCCTGCTTCTTATTCTACCAT GAATGATGATAAACTTGAAGTTCAGAATTGGGACATTGGCTTAAAAAGCA AATTTCTAACTGTTGAGTTCTAGCACCAATCCATTTACACATTTCATGGC TTGTAATTTGTATGAAAATCATGCAATACAAACTTCACTTTGCTGTATCA GTGATTCCTGCATGTTGTTCTGTACATAATGTAGGTATGATGCTGTAAGT GGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGA GTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGTTTGGGTTATTTCA TAATCTTACAAAAAACTTAAGGAATCTTGATACACTATCCTAGCTCCCTC TACGTTAGATGATTGTAACTTGATTGTAACTTGAGTACACTTAAGTCAGA ACTTAAGATGAGTGAACATGACTACAGTACATGTACATGTAGGACACTGC ACACAACATATAAGGCAAAAATGCAGAACTGATTGCAACAGATAGTAGTA TACCATTAATCTTGTGTTAGTTCAGTTCAATCTGCTTCTCAACCCAAGTT AAGATCTTTTCTGCCTGACTGATGATGATGTGACTCACAGTATAGACTAT TTTCCTACGGTTTTCCAGGCACCATGACGTTTGTTTCCAGTATCAGGATA ACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTT CCAGAACATCAGTACAGAGATCAAGGATTGGGTAGGACTACATTTATTTA ACTTACTGTTTCTGTTGGATGTATACTGGTACAGAAGAACCCAAGCAACG TGCCCTCATAAATTTGAGATGTACTATATGGAACAAATTCTGACAGAACC AGAAAATTCAGAAACAATTGACTATTCGTGATCATCTGCTAAGCCACTGC CTGGTCAGAATGCCCCTTTACATCTTCAACAAATATAACAGACTTAAACG TCACCCTTTCAAATGGACTTAGATCCTGAGTAGAGTAACATAAATACATT ACTTTTTTCAGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCA ATCAGAGTAAAGGATGCAAAGTAAGTTTATATCACTATGTTAATGGTTTT TGTTTCCTTGAGAAATGTATAACTTAACTTTTTTTTTCCAGTTGCAGAAG TATTTCAACTATTAGTAAATCATTCATGTGTAGAAGGTATATAATGGTCG AGGTATTAATGTTTCAAGTAACTGACAAAAAAAGCTGTCACAATGGATAC AGGATTAATCAATCTAATGTTAGTTTGGGGCTTTAAAATTTTGTCACTGT CCATAGATTTTGATTAACAATGCATAATAATGCATTTGTTTTGCTTTGCA ACCGTTACATTGCCTGACAGCGTTCTAAAGTAAACTTCCTAAATGCAGTT ACACCAGAAAAGATTTTTCAGAGGACTATCATATATTTCTTGCAGACCAG GATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAA GACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCA GTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTG CATGTATGTTTTAACGCTCCTGTTCTTTTGACTTACTTACAAAATAAATA GCTCAGAACTTTCCGCTGAGAAATCATAGTCATACATTAAAGTTTCCCAT TGTCTCATCCTACAATCTGAAATCTTTATAAACTGTCATTGTCAGACAAG TTCAGAAATATAGTGTCTAAGTGTGCAGTCAAACCTATCAACATGTGACT TAAGGGACCTGCGTGAACTGGTCATAGTAGACAGATGGCATTCTTAATGT TAAGTGTCAATGGAAAAAATGTATAATTAAGGGAAGACAGGTGGCCACTA GTACGAACATAACCGCATGCGCATAAATGCCTTCTTTGTAACCATGAGTT GTATGACAAGACAGGCCCCACTGTTCTTGCTGTGCCTTAACAAACAAATG TCATAATCTAGGACATGTCATGTATCATCAAGACATGTCATCACAAATGG ATAAGACCTGCTCTTCTTCCCATAGCAACATGTTACGGTGAAACAGTGAC TGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTG CAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAA AGTGGTAAGAAGAAGATGCAATAAGAATTCACCATATCTTTGTAATACTA AGTTGTAAACGCTGGATAAACCTGTAACATCTAAGAACATTATTCATGTT ATGGCCTTAATGATAAGTCAATGATGATTTGTATGGTAGTTACTAAGATA TGTTTTGTTGTAGGAGGATTGCACAGCACTAGTAGGTCTAAGGTAAGGTA AATGTATTTCTGACCATTTCGTTTGAATCTCCAGCTGGTATTCCGCGGGC AGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCC CTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGGTAATG TATAATGCAACCAAGGGTTGTCGGGTGTGATTGGATCTAAATTACATCTT AATTGAACTAGTACAGCCAACTTAGGTGTAAGTCTAGTCTAGATGAATAT CTATTTTCGATCAATATCTGGTATAGGTAAATACATGCATCAAGTTTCTG AATTGTGCATGTACACCTGAATCAGATTCACCACAATAAAGACTGTGCAT GCCTAAAAACTATTTGTTGACTTGAAGCTTTTCCTTCCTGAATGAAGAAT ACATCACCAACTCTATTGGTTCAACATGATTGAAATGCTGACAACTGAGA TGACTATGAAATTTATTTTTGCAAGATATTTTTAAAGTGAATGGGCTGTA TTGACATGAAGTTTCCTTCTTGGTTTTTCAGATGCCTGTTACTGAAGGTA ATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGA TCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACAT CGCAAATACAACTGGAGATGAGAATGTGAGTCCTAAGATTTTGGCGACAC CTCAGATGGAGCTAAAATTACTGTTGACTTCATTTTTAAGCTAAGAACTC AAGATGCTTTTGCTACACGTTTGACCATTATTTTACCTCTTAAGAAAACT TAAAATCATCTGATATCTCATTTTGATTTTGTTATGTATGCTTGAACTGC AGGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAA GATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGGTA CAAAACATTTTCTGATTATGATATCTTCAATTGAAATTAGGTAGAAACAT GGGTAAAACATTTCAAATTTGAATGCATGGTGAAAAGATCTTTTGTATTC TGATGGTTATAAAGGACATACCGGTATGTAAACTGCATGATGACTTTTAT AATTATCATAAAATAAAATTCAATATTATCTGTTGAGGCTATGGCCTGTT AATGTTGCATACCTGGCGTTATCCGTTTGTTGTTGCAGAATCGTACAGGC GCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCC GCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAA CTTATCAACAGGTAAAACACAGAAACAGGTTGTTGATTGTATGGCAGGAT AATATTATCCTGGGTTTGTCTATCTGTGTTTGGTAACCACTGCTTGCCAG CATGATCTGAGAAATAAAGTACAATGGCAAAAGCCTTAGTTAACTGCATT CCAACACTGTTTGACTGTTTGTACTGCAACCTTAATCATGTTTGAATAAA ATGTCACTTGGGATATGTGACCTCACAGCCCTATATGGGATCAGCAAGAA AGACGGAGACATTTATACCGACCCATCTCTATAGCAGGAAAACTTCTTAA GTTTCTTTTGATGCTTTTTTTCAGCGTTGGCTTTGCATCCCTCGAAGGCA GTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTC ATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGG ATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGGTTGGTTTCTCTTTT TATGTTGTGATCTTTCAGCATTGACTGAAAATTAATTACTGATTTACTAC TGATTTAGCACCTACACAGACACACACACGAAAATACAATTCACATTGTT TTGGACCATGTTTTAAAGTATTAACCAATTTAAATGGGAAATTTTCCATT TTGTTTTCTCAAGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCAT CTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAG CCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACT GGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCC TATCGTAAGTAAATATATCAACAATAGGGATTTGTACATTATTTCATAGG TCCAAATCAAATGAAACATAAGTGAGAGCCACTGACTTATGATTGTATGA AGTTACCAGTCCATATTGCTATGGCTACATGAAAAGTGGAAGTTAACTTT AAAAGGCCTGAAAAGGAATAATGAATAACAAAAGAAAATTTCGAACCAAA GAATGGGCCTTGTGCTATTCTAACACTTTAAGTCTTGGATACTGTAATGT TGTACAATGTCTTTTTTACTGTAAGGGATTATTGAAGTCAGTTTTCTAAA TCTTTCCACAGGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGG TGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAAC AGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGT GCAACCACCTCACCAACTTTGCTGTTTTGATGGTAAGTCATGAGGGAAAT GTGTTTCTTAGTGTCTCAGCCAAAACATAAACTTCAATAGAAACTGATTT GGGCTAAGAGCCTCCTCATACATGATAGTAAGCGGTTCTAAAAAGAGATC TGTTTGAGGGCAACCTACCCTGCAAAATAAAGATATCTTACATCACTGTC TTTAGTTGTGTGCCCATGAAAACGAACACCATGCATTTTTTCTACTTTTA AATTTGGCAAAAATCCCATTTTGTCAATGTCTAGGTTGTCATGTAGTGGT GACAAAAATGTGATGTGAACAAAATTTACAATGGACAAAAAATTTGTGAT TATGTTTATGTCCTAGTCATCACCATGTTGTATTTCAGGACATCTACGGG GGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCT GTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAGT AAGTAGGTCACATGATTCTGTCTGTCAATACATCTTTCTGCACTTCATAT AAATGAAAAGATAGTGCTTTCTTACAACGGATATTACGTAGCCTTTAACT TTAACCGTCTATTGAGCTACATTCAAACAGATTATTTATAACACTAAAAA TGAGTGTTGACATGTTTCACATGGTGCTGAAACTAGGTTTACATGTCCAT GGTGCTGAAACTGATGTTAGCATTCCATGGCACTGAAACTGATGTTAGCA TTCCATGGTACTAAAACTGCTGTAAGCATTCCATGGTACTAAAACTGCTG TTAGCATTCCATGGTACTGAAACTGCTCTTAGCATTCCATGGTACTGAAA CTGTTGTTAGCATTCCATGGTACTAAAACTGATGTTAGCATTCCATGGTA CTGAAACTGGTGTAAGCGTTCCATGGTTCTAAAACTGGTGCTAGCATTCC ATGGTACTGAAACTGATGTGAGAATTCATGGTGCTGAAACTAATGCTAGC ACTCCATGATGCTGAAACTGATGTGAGCATTCCATGGTACTAAAACTGCT GTTAGCATTCCATGGTGCTAAAACTGCTGTTACCATTCCATGGTACTGAA ACTGTTGTTAACATTCCATGGTACTGAAACTGGTGTTAGCCTTCCATGGT ACTGAAACTGCTATTAGCATTCCATGGTGCCGAAACTGAAGTTAGCATTC CATGGTACTGAAACTGGTGTTAGCATTTCCATGGTGCTGAAACTGCTGTT AGCATTCCATGGTACTGAAACTGATGCTAACATGTCCATAGAAATAAGTA ATGAGTCCTGGTGTAAATATGCTCATTAAGTGGGAACTAGTTTTTACATT TAGATGGTGCTAGAATATTCAAATTTCTATGGGGTTGAAACTGATGGTGT TAAAGGTGCCCTAAGCGACTTCAGGGGGTAAAACTTGAAATATTCTGGGG AAAACAATTCTGTTTGGTGAAGTTGAAATTGACATTTACTTCCCCATATT AGCACATCTGCATCATTATTTCATACTTTGGGGGCGTTTAAAAATAGCAC AGAAGCAAGCCACAAAAGGAGTATTCTATTTATTGGGTCCCCCTAAAAAT CAGCCCAGAATCCAGCTGTAACCGTTTTCTGTCAACAATTTTCGGTTATT TCCGGCCGCGTGACGTCACAATGCCCAAGCACATTGAGCCATGACCACGT GATTATTTCTTCGGAAGCGTTCGGGACTTATCGGTCAGAATCGTGCATGT TCGGAAGATTTGAAATGATGGCTGGCCTCCAAGTGCTCAGATTTTCAATG AGTTCCCACCACACAACGACATTGTATTTTTGCTCCATGATGGTCAATAT GCGATGGAATAGTGTTATCTAAACTTACTATGGATATAAATCAGAAAAAG ATTGATTTTGAATATGTGACTTTCAGTGCCCTAATATTGCTTAGGGCACC TTTAAGATTTTCATAGCCTCTCCTCACATTTCTTTCCAGACAACTTCGTC AGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCA ACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGG CTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCA TGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTC TTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATG GGGTGAGTACAGTAGCATCATAATGCAAGGTTGTTTCCAATAATATTTCA TACTAGTACTTAGAATTTCAGGAAATGTTAATGCAATATGGCATTGTATA GAATGGCAGTAATGGATATAATATCTGAAATCTTCGTCAGCGAAGACAAG CCAGAGAGAATGGATATAATAGCTGATTTCGTTTTACCGCTTGATATGCT ATTAATCTAGGTTTGTATATGTTTCAGGTTAATCTAGGTTTGTATATGTT TCAGGTTAATCTAGGTTTGTATATGTTTCAGGTTAATCTAGGTTTGTATA TGTTTCAGGTTAATCTAGGTTTGTATATGTTTCAGTTTAATCTAGGTTTG TACATGTTTCAGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTG GACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAG CTTGTAAGTTTCCATGTGTAAAACAGGGTTTTATCAACCATCTACCAAGC TCTCAGATTCTTGTTGCTAATGGTGGACAAAAATAATGACTGTAGTTCAG CTATTAGATTGCCTGCAACAGGGGATGCTAAGCCTTTGGATCCATGCTCA ATGAAATACTCAAACACTGGAAATAACCCATCATAATCCTTCATAAGATC CTCGTAGGTGTTAGACATGGTGTGATCTTGAGAACATTATAACTCACATT AGTTCTTGATGACATTTATGATTATGCTTTCTTTTAAATTTTGCTGGAAG CAACATGTTGTGTTATACCTTTTCTCTCATCACTCAGTATCACTGTTAGT ATAACTATGTGGTAGAGTTTTCCCTATCAAGATAATGTTTGATATTGTTT TTGACTAGTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTT ACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTA TCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGTCAGTTCTCATATCAT TACATCATCTTCACTGCATGTCAATGCTTAGCACTGAGGCGGGCCATCAT TGTCTTCCACAGTTTTCATAGACATACCCAAGTTTAAAGGATTGTTATCC CCAACTCATGGTGCACATCAGTATCATAGTAAATTTTACTATCATCATCA TCATCATCATCATCATTGGCAGTAGCTTGTGTACGAGCATTTTTCCATAA ACAAGAACCAATTGATGCCTTAATGATATTATTTTAGTCATTTATGAAAG AGAATGGCTGCTGTTTAAACGACAGTATGTTCATGCGGAGTCACAATATG TCTAAACAATACCATTGCATATCTACCATGTACATGTAGCATGCAAAATA GAGCTGTTAGATATTGATTGAAGTGTGACTTGTGACTTTTCCCCAGGGAG AGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCA TCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATG ATCAGGTTATTTGAGATTCAGATCTGTAGGATCTGTCATTACATTGTAAA GAGGTTGTGCAACAATATCCTGCAGCATTTAATTCAAATGGGATCAGTAA ATTAAAGTGCCAAACTTCAGTTTCTAGCAAAGATTATGAATTTGTTTGTT TTTGTTTGCACCTCCACAAAGGCTAAAATCATGTACAAGCAAACAATAAC ACATCAGACTTATGTAGTAAACATAAGCTGACACAATCTGTGAAAGGTAA CATTATCATCTTTTGAAAAATGTCGGCCATTAAAGTTTAGTTTCGCATAA TGCAGAGAAGGAAATTTAGACAGGTATCATATGCATGAAGAGAATTTTGT CATTATTTTGGATGATTCGTTTTCTTGCTTTAGCTATTATTTATATGTAG TAACATACTGATGACTAATCCATGGTGTTTGTCTAACCATTATTCCATTG TGTTCCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAA CTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGG AAGTCCAGAACCTTTGGTTCAAGTAAGTAGACCTTGGTAGCTCTAACTAA AGGCTAAATGTTTAAGATGTCTTCTGTGTGCCTTGCCTTTGCTACATAAC CTGCCAAGATGATAACTGCTAATCATCTGTACCACACCATGCTCTTATGC AAAAGTTTTATTTAATCAATGCGTAAGGTTTCTATAAATTTTTGTCTATC CTTCATCCTTTATATTTTACATAAGTGTTGCATGCAGTTCTCCTGTGGGC TGTAAGGTGGCTAAACTTTGATTCCATTACTCGATACTTCAGGGTTCTCC TTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAG TCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGG CTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATG CATATACGAACATTCCCATGAACAGCATCTAAGGCACATTTAAGGCTGTT CAAATCCAGGTTTCTTGCTTGACTAGATTTTCTTAAGTAATCTCAGCAAA CCAATATGCATGCTTGCCTGTCGGCATAATTTGACCAAATAGTCTTTACG TACATTAGATATGTCCAAATTGGTCCATCCATATCACAGAATGGCCATAA TTTTTGTTTGTCTTTGGCAACAAGATTTTACAAAAATGATGGAATGACAT AAGCTGGGGGAAACCATGTTCAACTCCAATGTGGGGGTTAGAATATTTTT GGGAAATGAAAGAGACTAAGAAGAACTGATTCAAGACTTTACAACTTTTT CTTCCAGGCCTCTGTTTTTATCTCATTCTCATACTTCATTAATTTTGTAA ATCTAAAATGTGTAAAAGCCAAGTGAATATTGAAGCCTTATCATTTTGTG AGCTATGCAAGATTGTTGGAAACGCAAATAAATTTGTACTGCCAAGGCCT TCACAGAATACTGTAACAACTGTACAGGGTAAATAAGTTAGCTTACACTA TGATTAAACTGAGCATTTACCATTTCATTCACAATAATGCACATCACATA ATTATACAAAAGGATCAGCACATGGTGTAGCAATTAAAATATGTATTTAC TATTTAATTCAAATTGAGATGTATATATTTGCTTGTGCACTTAGTATTGG ATATCAGAATTGAAATCGAATCTTGTATTTTCCTGTACAACTGTCTTTTA TATTTTTTGAAGTTTTCAATCAATCTATTTTCACACTTTAGGCTAGGTTA AGTTGTTAACTTATAGATGGATGCCTAGTAGTCATTGACTTACATGTAGT GTAAAGTAGAGTTAGAAATTAATGACTGCATGTTAATATTCTAACATGAG ACTCATTGTAGCATAGCATATACTAGTACATGAATACGCTTGGTTCCGTT ATTTGAAGTTGTTAGTCATATGTTAGCACATGTTTGCACTTTAGTAGGCA AGTTCAGATTAGAAAATGTTTTGCACATGTTGGGATGTAATAATTGATCT TGCTTTTTCTCATTGCTGGCATGTACCAACAATAAGCCATGTTATTGTTT CCTTCAATGAATCATATAGTTATAAATGAAAAATCTGAATCAAACAATCC TGGTGATGTATTTAGGACCTGTTACACATTTCCTCACTTTGCAAGTTTAT ATCAAGACATAGTTTTTGAAAAGTCCTATAGTACTTGATTGCCTATGCTG TATGATAATGTATCTGCACAATTATAAAGTATTTTTTTCTTTTTAAACTA AGAGTAATCATAATGAGTTTTTAGATATGTCCAGTTGCTTGATGTACTGT CCATGTTGGTACTCTGTTGGATATACTATGCTCCATTATTATTCCAATAA ATCACACAGTATGAGGGATATTGCTCGGCCATTTTATTTGTCATTTCTTG GTGGTGCTTTTGAATCATCTTACTGGGGGAATGACATAGAAATAGAAATA AACAAGTAAGACATAATTATAGGAATATACTATACTATACTGCTATACAG

Coding sequence (CDS) from alignment at Sc0000034:1201381..1221080-

>transcript:BL97387_cuf5 ID=transcript:BL97387_cuf5|Name=transcript:BL97387_cuf5|organism=Branchiostoma lanceolatum|type=CDS|length=171963bp|location=Sequence derived from alignment at Sc0000034:1201381..1221080- (Branchiostoma lanceolatum)
TCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAA
ACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAA
AAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGT
ATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCA
CCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAG
TTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATG
TTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCA
ATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTT
TGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATGAA
GGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAA
TGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAG
CTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACAT
TACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGC
TGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGT
TTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCT
AACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAA
GGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACA
GCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAG
AGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATT
TGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATC
AGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACA
GTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGG
AGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAAT
CTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCA
GTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGT
GAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTG
TGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAG
GGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCT
GAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAG
GATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGT
AAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGC
CCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCC
CACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGAC
AGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTA
TACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAA
CGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACT
GAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCT
CGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACA
CAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTA
CCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCAC
GATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATG
TCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGT
GCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGT
GCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTG
TGAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGG
TCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGAT
GGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCA
GTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGG
TATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTG
TGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCC
CTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAG
ACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTA
CCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCT
TCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACA
AGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCC
AGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCT
TCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGT
ACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCA
GGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCC
AGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAAT
GGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGG
GGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTG
AAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTC
CCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAA
CAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAA
GTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGG
CTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGC
AGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGA
CGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAAT
ACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCA
GATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATC
AAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTC
AATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGA
AACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCAT
CCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCT
GACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCC
TGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATC
CAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGG
TTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAG
GGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGA
ATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGT
ACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGC
TGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGA
TTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCT
GTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGAT
CAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCA
TCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTC
CTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGC
AGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTC
TACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCC
TTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAG
ATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTG
CCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAG
GAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTA
CTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCG
TGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGG
AGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGC
CATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCA
TGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAAC
TCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGA
AGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCT
GTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCG
TCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAA
AAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGA
ACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAG
CGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGA
CACAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATC
CATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAA
GAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAA
CGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATAC
CTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCA
ACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAG
AGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATT
ATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTT
CAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGT
TGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTG
TCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGC
CCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGA
CGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAA
CAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAAT
GGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGA
GTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCA
GGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAA
GAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTAT
TGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAA
CCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTC
AGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCT
GGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGA
CTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAG
GGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAG
TACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTAT
GGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAAT
GGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAG
GGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTG
ATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCA
CCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAG
CGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCA
ATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAAT
ACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAAC
TCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGT
TGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGT
TTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGC
ACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAG
GGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAAT
CTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCG
TCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACC
GCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATT
TATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAAC
AATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCA
CAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAA
ATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACC
AAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTT
GCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGAT
GGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATG
TTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGG
TTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGT
GATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAG
AGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGT
GCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTG
ACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAAC
TGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCC
AGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGT
GTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGT
CATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGG
ACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCG
AGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAAC
ATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGA
CCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAA
AGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAG
GTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGC
TGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAA
GGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGG
AGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCA
ACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTG
TCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCA
AGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCA
ATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAAC
ATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGT
TGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTAC
GATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCC
ATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAA
TATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATC
AGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGAC
ACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTT
TGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCG
TTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGG
GACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGA
CTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCA
CCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCG
CTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGT
CCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGAC
CACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATC
ATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGT
CGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGG
CCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCA
CACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCC
CTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATC
CTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGT
AACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTT
CAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCA
GGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAG
CTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTT
TGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCT
GCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTA
CGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAG
GTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAG
GAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGT
GGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAA
CATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCA
CGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGA
AGACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGA
CACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCAC
AAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCA
ATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGT
GGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGAC
CTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAG
TTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTA
TTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGG
AACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAAT
GACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGG
AGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGG
TCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACC
ATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGAC
AGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATG
AAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGT
GGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAAC
TGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGT
GTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACT
TATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGA
TGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACC
ACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACA
TATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGT
AACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTG
TAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCT
GACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGG
GCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCC
CTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAA
CTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCA
GCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGT
ATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCG
TGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAA
CAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCA
CTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTC
TTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGC
ATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCAT
CAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCG
TCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACT
CTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGG
GCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTC
AGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTC
ATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGC
ACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACC
CTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACA
AGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCA
TCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGG
AATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAG
CCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGG
CAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAG
TACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGT
TCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAG
GGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTA
CCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCA
CAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGG
ACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGT
ATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTC
AGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAG
CTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAA
CCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCT
CCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTG
CCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTA
AGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATC
GAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGT
ACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGG
GCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAG
CCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGC
CTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTT
ACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAAC
TGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATT
CCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTT
TATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCT
GGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCA
TTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTT
ATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGA
TGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAG
TGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTT
CTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTT
CATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTT
CCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGA
GTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATA
TCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGT
GTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACA
GAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTG
CAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGC
ACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATC
ACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCG
TCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGG
CAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTC
GGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTT
CATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAG
TCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCA
TGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCC
CAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCT
GGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTG
GTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTAC
CTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGA
CCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTC
ACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTC
CTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCT
TCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTC
CTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAA
GTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAG
GCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAAT
GCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAA
CCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTC
CAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCAT
ATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATT
AAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGA
ATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACA
ATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGC
AGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTG
CCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGAT
GACTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAAT
GGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGC
AAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAAC
CGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGT
TCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGG
AGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAAC
TACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGT
CTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGA
CAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTC
CCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAAT
GCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAG
CTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCA
GCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTT
CCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACG
CAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCC
ACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCC
CAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACC
TGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCA
TCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAG
CCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTT
GGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTAT
TACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCC
TACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTG
CTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGG
TTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTT
TGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAG
AGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTA
CAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGG
GGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAAT
CCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTG
CAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAA
CGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAA
AACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTT
GACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACC
CGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAG
AACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAAT
GATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTG
CCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCAC
CCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGT
CAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGT
GGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGG
TGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGC
CCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTG
TGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATG
GAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTA
AGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGAT
GGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGT
TTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACA
GACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTG
GTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAA
AGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAG
GATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCT
GAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTG
TCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACA
GACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGA
CACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTG
GTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTC
AGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACT
GGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACT
TACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGA
GATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAA
TGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAG
ATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATC
GTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCG
TTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAG
CTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAA
GATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCC
CAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAG
TTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTC
CGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCA
GACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTA
TTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTG
GTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAG
CAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGG
CCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTG
GTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTA
CGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTG
CCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTC
AAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCT
GGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCA
GTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTC
TTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGC
CTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAG
CCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTT
GTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCAC
CAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTAC
CTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATC
AGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGG
AAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGC
TGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGG
ATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTT
CATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGT
TCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTAT
CGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTC
TACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGA
CAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCA
GGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTT
GATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGA
CAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAG
CGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAG
GGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCG
CAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTA
ATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACG
TGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGC
CTTGTGATGATGACTACGATTATTACGATGATTATGATTATGAAGGATTC
GGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGAC
AACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGC
CTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCC
ACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGT
GATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCA
GTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAG
AGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAA
GTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTG
TGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTG
TTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGAC
AAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAG
GATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGAC
TGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGG
GACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCA
GCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGAC
CTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACAT
CACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACC
CGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAAC
TGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGC
GTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCAT
GCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGC
TTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTA
CAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTT
CAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAAC
ACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTG
TGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCA
GCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAAC
CGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATC
TGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCA
TCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGG
ATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACT
GTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGT
CAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAA
CCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGT
ACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACG
TAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAAC
ACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATA
CATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGT
CCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCT
GAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGG
GCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGG
TCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTC
ACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTG
GACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGT
ATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCA
AGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGG
CACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCC
CTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAG
ATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATC
AATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACA
TTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATC
TCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGA
TCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAG
TGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGC
TCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACAC
GGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTG
AGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGAC
TTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGT
TGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAG
GAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACT
GGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAAT
GAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTC
CCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTG
ACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTA
CCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCG
AAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCA
TCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGA
GCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAG
ATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTC
CAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAA
CAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCC
CAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAAC
AGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGG
AGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACA
ATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTG
ATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAA
GATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCT
ATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATC
AACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCAT
TAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGC
ACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAAC
ATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCT
CCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCA
TTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACC
TACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGG
GTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATA
TCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTT
GCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGC
TGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCA
GTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTG
CAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCA
GAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTG
CGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAAC
CAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAG
CACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCA
TCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATA
ATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGA
AACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAA
AACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATC
ATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTA
TGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTA
ACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTT
TGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTA
CAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATT
ATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAG
GGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAG
GAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCC
GACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCG
GAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCAC
AGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTG
TTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTT
CACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGA
GGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATG
TCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTG
ACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCC
TTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGG
TGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAA
GCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGG
GCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTG
GTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAG
AATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACC
AGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCT
ATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGA
TGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGG
AGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAAT
ACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTA
AAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGG
CCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTT
CTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGA
AATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGAC
AGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGC
AGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGA
TATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACA
GAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAAT
CGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAAC
GTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCG
TGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCA
AACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGA
AATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGA
ACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAG
AGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAG
TTGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGA
TTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAAC
AAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGAC
AGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGT
TCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCG
GAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTAT
AACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGC
TGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGG
TGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTG
CTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAG
GAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACA
TCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAG
GGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGC
AACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCT
ACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCT
CTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTA
CGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGA
CTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGT
GCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCAT
TGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACT
GTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAAT
GTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATC
ACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCG
CAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTC
GACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTAT
GGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATC
GTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGG
GTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTT
TGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTT
ATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCT
CTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACC
TGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCA
GCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAA
ACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACT
CAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGA
ACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTC
AATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGT
TGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACT
TTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGAC
TTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCAC
CCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGC
ACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTC
CTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGC
ATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTG
AAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTG
TCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGT
TATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATG
GACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAG
CTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACAC
CATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTA
AAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGC
ATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATT
CTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCT
TCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAA
AAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTG
CGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGT
CATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACAT
CGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCC
CATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAA
TGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGC
CATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGA
CAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGC
AGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTC
CCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGT
TATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATA
AGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAG
TTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGA
TGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTC
CAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGG
ATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGA
CTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCA
TAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACA
TGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGA
TGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCA
TAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAG
ATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACT
ATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCA
GAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACT
TCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACA
AGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTA
GTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGAC
AACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGC
TGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTC
AGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCA
GACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAA
ATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAA
GCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCA
GAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTT
TCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCA
CCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATT
GCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACC
AGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAG
CCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAAC
CAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTAC
AAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATG
CTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTT
ATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGT
CGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAG
TAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCA
CTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGC
TGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAA
AAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAAT
GTAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAA
CATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATC
CAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATC
ATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTC
AGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGC
CAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAG
AAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGA
TCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTC
CCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAAC
CAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGT
CAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCA
CTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGG
ATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGC
TTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGG
GAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGA
TCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGA
CAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGT
CTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCA
TCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCG
TGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTA
CTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTT
CGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGA
GCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTA
CTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCT
ATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCT
GGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGG
TTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAG
AGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCA
GTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAAC
AAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAAC
AGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATT
GGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATG
CTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAG
GAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCAT
CTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAG
CCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACT
GGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCC
TATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTT
CCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGA
TGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCA
CCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCT
TTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGC
CTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGAC
TCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTC
TTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGC
ACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTG
GATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGG
GGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGT
CTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCAC
CTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGC
AGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTA
CTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAG
GGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGC
AGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGG
ATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTT
ATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGT
GTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACA
TTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTC
TGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACT
CGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATAT
ACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAA
TGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAA
GAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAA
TCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAA
TCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGC
TGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAA
CCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGA
GGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCG
CAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTAC
GATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACC
AACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGT
ACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGT
GTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCC
TGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTG
TCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTG
TGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAG
GTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTT
CAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAA
GGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGG
ACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATG
GCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATG
ATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGT
GTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAG
TAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGG
CAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACA
AGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGT
TGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGC
GTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGA
GTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGA
CAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTG
GACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCT
ACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGC
TGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGG
AACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTC
TGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAG
AGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGA
CTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATG
TGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTT
GGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTT
CAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGC
AACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAA
CGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGT
CAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAG
TCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGC
CGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATC
ATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGAT
AGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCA
ATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAG
GAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAG
GAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTA
GTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCA
GAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGC
CACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAG
TTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGT
GTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTC
TGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTT
CCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCA
AACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCA
GCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATG
CAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCT
GTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAAC
AGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACAC
TCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCA
TCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCA
TGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTC
CGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGG
ACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACA
GATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGA
TTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCC
TCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGG
CTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACA
TCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAG
GCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCG
CCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAG
AACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTA
GAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGA
CCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTG
CATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTG
AGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGC
TCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCA
GTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACA
AGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACAT
CAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGT
CAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGT
GAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGG
CTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGT
CAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAA
CTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCT
ACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTC
CGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCT
GTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGT
GAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTT
TAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGAC
GTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTT
TTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTG
GACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAG
CTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGG
TGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCG
GGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTC
TTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTT
CATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGG
TTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACA
ACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGC
GGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGC
CTAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTG
GTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGA
GGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACA
ATCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAA
GAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTA
CAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACA
TAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAA
GTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGT
TGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTG
ATGATGACTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCC
ACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTG
TCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATG
GTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGT
TTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGT
AGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATT
ATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGAT
GCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAG
GGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTG
TGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACA
TCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGC
TACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTC
TATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAAT
CAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACT
TAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAA
CTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTG
TTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCT
ACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACT
GTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGAC
TTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCA
AGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAG
ACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTT
CGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCA
GCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTAC
GCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATC
GTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTAT
TGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGG
AACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTA
TTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATT
CGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATC
AGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGG
AGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCT
GGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAA
TCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAA
CAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGAC
AGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGA
TGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACA
TTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATT
TGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCC
AAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGG
CTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGA
CCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCA
TACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATC
ACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGT
GGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATG
CTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGT
GAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCAT
GACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGA
TGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAG
GATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAG
AGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACG
TGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAAT
GCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAA
CAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTG
TGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCA
GGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAG
TGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTG
GAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCC
AAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGC
AGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACA
TCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGAT
GAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACAT
TGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCA
GAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCA
AACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGAT
TGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCA
GTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTC
ATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGG
ATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGG
AAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCC
AACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAG
GGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACC
CAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACA
GTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGG
AGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACA
GGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGAC
ATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGG
GATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGG
TATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTG
TGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGC
CACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACT
TCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTAC
CTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAA
GGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCC
TGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGG
AGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCT
GTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGG
TTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGAT
CCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCAT
GGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATG
GAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGA
TTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCT
TTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACA
TGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACT
GAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCC
GGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAAT
CAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAA
CCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAA
AACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTA
TCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCAC
CAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGT
TTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGT
TACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAA
TTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTT
GCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATGAAG
GATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAAT
GTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGC
TGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATT
ACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCT
GAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTT
TCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTA
ACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAG
GTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAG
CACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGA
GTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTT
GGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCA
GAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAG
TTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGA
GAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATC
TTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAG
TGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTG
AACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGT
GAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGG
GAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTG
AGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGG
ATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTA
AATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCC
CTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCC
ACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACA
GCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTAT
ACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAAC
GGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTG
AGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTC
GAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACAC
AAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTAC
CATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACG
ATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGT
CAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTG
CAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTG
CTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGT
GAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGT
CAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATG
GGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAG
TGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGT
ATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGT
GTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCC
TGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGA
CCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTAC
CAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTT
CAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAA
GTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCA
GAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTT
CACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTA
CAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAG
GTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCA
GAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATG
GTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGG
GTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGA
AACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCC
CAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAAC
AACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAG
TTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGC
TGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCA
GAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGAC
GATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATA
CAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAG
ATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCA
AGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCA
ATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAA
ACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATC
CCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTG
ACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCT
GGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCC
AACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGT
TGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGG
GTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAA
TCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTA
CAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCT
GGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGAT
TGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTG
TTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATC
AGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCAT
CACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCC
TCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCA
GGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCT
ACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCT
TCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGA
TTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGC
CATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGG
AGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTAC
TTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGT
GTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGA
GAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCC
ATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCAT
GATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACT
CCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAA
GTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTG
TCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGT
CCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAA
AGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAA
CAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGC
GCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGAC
ACAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCC
ATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAG
AGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAAC
GGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACC
TGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAA
CGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGA
GCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTA
TGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTC
AAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTT
GCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGT
CACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCC
CCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGAC
GCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAAC
AGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATG
GTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAG
TCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAG
GGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAG
AGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATT
GTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAAC
CTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCA
GAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTG
GATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGAC
TAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGG
GACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGT
ACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATG
GACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATG
GACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGG
GGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGA
TAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCAC
CAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGC
GGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAA
TATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATA
CTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACT
CTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTT
GCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTT
TTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCA
CAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGG
GCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATC
TCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGT
CGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCG
CATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTT
ATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACA
ATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCAC
AGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAA
TACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCA
AATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTG
CCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATG
GAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGT
TTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGT
TATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTG
ATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGA
GGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTG
CAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGA
CAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACT
GCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCA
GAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTG
TTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTC
ATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGA
CCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGA
GTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACA
TGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGAC
CCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAA
GGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGG
TGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCT
GGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAG
GTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGA
GGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAA
CATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGT
CTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAA
GTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAA
TGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACA
TTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTT
GGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACG
ATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCA
TAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAAT
ATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCA
GAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACA
CAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTT
GAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGT
TGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGG
ACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGAC
TTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCAC
CAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGC
TGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTC
CTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACC
ACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCA
TCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTC
GTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGC
CATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCAC
ACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCC
TTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCC
TGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTA
ACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTC
AACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAG
GACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGC
TACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTT
GGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTG
CATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTAC
GTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGG
TGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGG
AAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTG
GACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAAC
ATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCAC
GATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAA
GACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGAC
ACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACA
AGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAA
TAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTG
GACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACC
TGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGT
TTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTAT
TACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGA
ACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATG
ACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGA
GCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGT
CATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCA
TCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACA
GTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGA
AGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTG
GTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACT
GTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTG
TGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTT
ATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGAT
GTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCA
CAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACAT
ATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTA
ACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGT
AGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTG
ACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGG
CTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCC
TGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAAC
TTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAG
CCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTA
TATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGT
GCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAAC
AAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCAC
TCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCT
TTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCA
TGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATC
AGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGT
CATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTC
TTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGG
CGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCA
GACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCA
TCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCA
CCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCC
TGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAA
GTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCAT
CTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGA
ATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGC
CTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGC
AGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGT
ACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTT
CAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGG
GTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTAC
CTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCAC
AAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGA
CAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTA
TCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCA
GCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGC
TGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAAC
CAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTC
CAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGC
CCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAA
GTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCG
AATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTA
CTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGG
CAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGC
CCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCC
TGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTA
CATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACT
GTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTC
CGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTT
ATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTG
GAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCAT
TGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTA
TCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGAT
GGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGT
GGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTC
TCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTC
ATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTC
CTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAG
TCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATAT
CTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTG
TGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAG
AGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGC
AACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCA
CAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCA
CGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGT
CAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGC
AACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCG
GCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTC
ATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGT
CTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCAT
GGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCC
AGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTG
GCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGG
TCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACC
TGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGAC
CAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCA
CCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCC
TACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTT
CCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCC
TTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAG
TCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGG
CTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATG
CATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAAC
CTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCC
AGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATA
TTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTA
AACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAA
TGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAA
TAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCA
GAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGC
CTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATG
ACTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATG
GGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCA
AAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACC
GGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTT
CCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGA
GACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACT
ACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTC
TTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGAC
AAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCC
CAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATG
CAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGC
TGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAG
CCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTC
CCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGC
AAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCA
CTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCC
AGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCT
GCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCAT
CATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGC
CTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTG
GTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATT
ACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCT
ACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGC
TAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGT
TGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTT
GCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGA
GAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTAC
AGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGG
GAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATC
CTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGC
AGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAAC
GAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAA
ACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTG
ACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCC
GTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGA
ACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATG
ATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGC
CAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACC
CTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTC
AAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTG
GCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGT
GACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCC
CTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGT
GACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGG
AACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAA
GTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATG
GAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTT
TGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAG
ACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGG
TATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAA
GGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGG
ATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTG
AAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGT
CACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAG
ACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGAC
ACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGG
TATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCA
GCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTG
GCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTT
ACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAG
ATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAAT
GTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGA
TGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCG
TACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGT
TTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGC
TGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAG
ATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCC
AATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGT
TGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCC
GTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAG
ACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTAT
TGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGG
TGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGC
AACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGC
CTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGG
TGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTAC
GGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGC
CCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCA
AACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTG
GCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAG
TTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCT
TGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCC
TTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGC
CATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTG
TGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACC
AGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACC
TGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCA
GTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGA
AAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCT
GGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGA
TTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTC
ATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTT
CAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATC
GTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCT
ACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGAC
AGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAG
GTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTG
ATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGAC
AGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGC
GCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGG
GTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGC
AAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAA
TCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGT
GATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCC
TTGTGATGATGACTACGATTATTACGATGATTATGATTATGAAGGATTCG
GGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACA
ACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCC
TGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCA
CATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTG
ATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAG
TGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGA
GAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAG
TGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGT
GACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGT
TTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACA
AGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGG
ATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACT
GGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGG
ACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAG
CTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACC
TATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATC
ACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCC
GAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACT
GCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCG
TTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATG
CCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCT
TTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTAC
AGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTC
AGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACA
CCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGT
GTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAG
CTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACC
GGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCT
GAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCAT
CTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGA
TACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTG
TGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTC
AAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAAC
CTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTA
CTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGT
AACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACA
CTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATAC
ATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTC
CCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTG
AATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGG
CCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGT
CAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCA
CTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGG
ACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTA
TGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAA
GTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGC
ACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCC
TGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGA
TCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCA
ATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACAT
TAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCT
CCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGAT
CCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGT
GACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCT
CTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACG
GAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGA
GACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACT
TGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTT
GCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGG
AAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTG
GAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATG
AACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCC
CTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGA
CTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTAC
CAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGA
AGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCAT
CCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAG
CTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGA
TGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCC
AGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAAC
AGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCC
AAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACA
GCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGA
GGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAA
TAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGA
TGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAG
ATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTA
TCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCA
ACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATT
AATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCA
CTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACA
TGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTC
CTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCAT
TACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCT
ACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGG
TTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATAT
CATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTG
CTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCT
GTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAG
TGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGC
AAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAG
AACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGC
GGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACC
AAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGC
ACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCAT
CTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAA
TCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAA
ACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAA
ACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCA
TCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTAT
GAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAA
CATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTT
GCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTAC
AGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTA
TGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGG
GAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGG
AAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCG
ACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGG
AAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACA
GGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGT
TCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTC
ACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAG
GACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGT
CCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGA
CATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCT
TATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGT
GACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAG
CTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGG
CAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGG
TCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGA
ATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCA
GTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTA
TCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGAT
GTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGA
GCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATA
CCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAA
AGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGC
CCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTC
TGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAA
ATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACA
GCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCA
GACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGAT
ATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAG
AACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATC
GTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACG
TCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGT
GATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAA
ACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAA
ATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAA
CCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGA
GGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGT
TGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGAT
TTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACA
AAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACA
GTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTT
CCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGG
AGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATA
ACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCT
GTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGT
GACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGC
TCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGG
AGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACAT
CAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGG
GCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCA
ACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTA
CAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTC
TTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTAC
GGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGAC
TTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTG
CAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATT
GGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTG
TGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATG
TGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCA
CTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGC
AAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCG
ACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATG
GATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCG
TGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGG
TGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTT
GCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTA
TTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTC
TGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCT
GATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAG
CCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAA
CCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTC
AAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAA
CAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCA
ATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTT
GGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTT
TGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACT
TGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACC
CTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCA
CCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCC
TGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCA
TTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGA
AGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGT
CTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTT
ATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGG
ACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGC
TGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACC
ATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAA
AGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCA
TCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTC
TTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTT
CAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAA
AGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGC
GGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTC
ATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATC
GGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCC
ATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAAT
GCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCC
ATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGAC
AATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCA
GGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCC
CAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTT
ATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAA
GCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGT
TAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGAT
GATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCC
AGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGA
TAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGAC
TTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCAT
AGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACAT
GTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGAT
GGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCAT
AAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGA
TGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTA
TGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAG
AGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTT
CTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAA
GCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAG
TCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACA
ACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCT
GAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCA
GCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAG
ACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAA
TTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAG
CAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAG
AAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTT
CTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCAC
CTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTG
CTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCA
GTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGC
CAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACC
AAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACA
AAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGC
TGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTA
TTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTC
GAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGT
AAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCAC
TTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCT
GACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAA
AATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATG
TAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAAC
ATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCC
AGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCA
TACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCA
GTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCC
AGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGA
AATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGAT
CTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCC
CAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACC
AGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTC
AAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCAC
TGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGA
TAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCT
TTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGG
AAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGAT
CTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGAC
AAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTC
TCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCAT
CAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGT
GTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTAC
TCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTC
GAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAG
CTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTAC
TGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTA
TCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTG
GGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGT
TGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGA
GTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAG
TTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACA
AAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACA
GCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTG
GTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGC
TTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGG
AAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATC
TATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGC
CGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTG
GTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCT
ATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTC
CTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGAT
GTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCAC
CTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTT
TGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCC
TAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACT
CGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCT
TATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCA
CTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGG
ATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGG
GGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTC
TTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACC
TATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCA
GGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTAC
TGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGG
GGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCA
GCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGA
TCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTA
TTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTG
TGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACAT
TCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCT
GGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTC
GCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATA
CGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAAT
GTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAG
AAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAAT
CGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAAT
CCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCT
GGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAAC
CAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAG
GGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGC
AGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACG
ATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCA
ACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTA
CAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTG
TGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCT
GAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGT
CACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGT
GGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGG
TATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTC
AGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAG
GAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGA
CTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGG
CACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGA
TAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTG
TACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGT
AACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGC
AGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAA
GTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTT
GTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCG
TGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAG
TTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGAC
AAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGG
ACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTA
CAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCT
GGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGA
ACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCT
GTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGA
GTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGAC
TGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGT
GCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTG
GCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTC
AACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCA
ACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAAC
GCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTC
AGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGT
CTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCC
GACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCA
TACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATA
GGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAA
TAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGG
AAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGG
AAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAG
TCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAG
AGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCC
ACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGT
TGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTG
TTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCT
GAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTC
CAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAA
ACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAG
CAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGC
AAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTG
TGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACA
GCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACT
CTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCAT
CATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCAT
GCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCC
GCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGA
CAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAG
ATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGAT
TCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCT
CAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGC
TATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACAT
CCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGG
CGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGC
CGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGA
ACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAG
AGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGAC
CAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGC
ATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGA
GTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCT
CCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAG
TAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAA
GATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATC
AGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTC
AACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTG
AGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGC
TTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTC
AATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAAC
TTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTA
CTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCC
GGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTG
TGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTG
AAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTT
AGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACG
TCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTT
TGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGG
ACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGC
TTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGT
GCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGG
GCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCT
TTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTC
ATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGT
TCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAA
CCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCG
GAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCC
TAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGG
TGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAG
GTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAA
TCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAG
AATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTAC
AGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACAT
AACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAG
TTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTT
GGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGA
TGATGACTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCA
CAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGT
CAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGG
TAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTT
TTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTA
GGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTA
TAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATG
CTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGG
GTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGT
GGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACAT
CAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCT
ACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCT
ATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATC
AGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTT
AACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAAC
TGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGT
TCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTA
CACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTG
TTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACT
TCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAA
GCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGA
CTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTC
GGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAG
CCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACG
CTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCG
TGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATT
GAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGA
ACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTAT
TGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTC
GAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCA
GCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGA
GTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTG
GGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAAT
CGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAAC
AACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACA
GAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGAT
GAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACAT
TGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTT
GCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCA
AGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGC
TTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGAC
CTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCAT
ACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCA
CCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTG
GATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGC
TGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTG
AGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATG
ACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGAT
GACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGG
ATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGA
GTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGT
GCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATG
CCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAAC
AGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGT
GACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAG
GAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGT
GCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGG
AGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCA
AACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCA
GACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACAT
CAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATG
AGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATT
GAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAG
AATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAA
ACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATT
GGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAG
TGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCA
TCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGA
TCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGA
AGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCA
ACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGG
GTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCC
AGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAG
TGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGA
GGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAG
GGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACA
TCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGG
ATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGT
ATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGT
GCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCC
ACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTT
CCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACC
TGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAG
GCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCT
GGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGA
GCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTG
TTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGT
TATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATC
CCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATG
GTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGG
AAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGAT
TCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTT
TGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACAT
GTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTG
AGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCG
GAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATC
AGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAAC
CTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAA
ACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTAT
CAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACC
AAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTT
TCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTT
ACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAAT
TACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTG
CAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATGAAGG
ATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATG
TGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCT
GTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTA
CTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTG
AGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTT
CCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAA
CCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGG
TCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGC
ACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAG
TCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTG
GGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAG
AAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGT
TGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAG
AGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCT
TTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGT
GGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGA
ACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTG
AACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGG
AAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGA
GGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGA
TCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAA
ATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCC
TCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCA
CCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAG
CAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATA
CCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACG
GCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGA
GAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCG
AATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACA
AGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACC
ATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGA
TACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTC
AGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGC
AGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGC
TGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTG
AACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTC
AAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGG
GATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGT
GAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTA
TTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTG
TTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCT
GAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGAC
CGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACC
AGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTC
AGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAG
TTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAG
AAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTC
ACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTAC
AGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGG
TATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAG
AACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGG
TATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGG
TGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAA
ACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCC
AAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACA
ACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGT
TTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCT
GGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAG
AGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACG
ATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATAC
AACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGA
TAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAA
GCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAA
TCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAA
CTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCC
CTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGA
CTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTG
GAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCA
ACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTT
GTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGG
TCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAAT
CTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTAC
AAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTG
GAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATT
GACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGT
TTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCA
GTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATC
ACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCT
CATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAG
GCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTA
CTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTT
CAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGAT
TTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCC
ATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGA
GACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACT
TCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTG
TATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAG
AGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCA
TCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATG
ATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTC
CCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAG
TCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGT
CCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTC
CAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAA
GCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAAC
AGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCG
CATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACA
CAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCA
TTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGA
GATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACG
GTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCT
GGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAAC
GGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAG
CCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTAT
GATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCA
AGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTG
CAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTC
ACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCC
CTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACG
CCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACA
GTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGG
TGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGT
CTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGG
GATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGA
GGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTG
TGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACC
TCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAG
AGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGG
ATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACT
AGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGG
ACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTA
CACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGG
ACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGG
ACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGG
GCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGAT
AAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACC
AGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCG
GCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAAT
ATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATAC
TGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTC
TGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTG
CGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTT
TGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCAC
AACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGG
CAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCT
CAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTC
GCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGC
ATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTA
TCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAA
TTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACA
GAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAAT
ACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAA
ATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGC
CAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGG
AGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTT
TCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTT
ATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGA
TTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAG
GTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGC
AAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGAC
AGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTG
CCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAG
AACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGT
TCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCA
TTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGAC
CTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAG
TTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACAT
GTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACC
CTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAG
GTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGT
GCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTG
GACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGG
TAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAG
GATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAAC
ATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTC
TGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAG
TTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAAT
GATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACAT
TGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTG
GCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGA
TCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCAT
AGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATA
TACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAG
AGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACAC
AAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTG
AACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTT
GAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGA
CTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACT
TTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACC
AACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCT
GGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCC
TCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCA
CAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCAT
CTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCG
TGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCC
ATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACA
CGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCT
TTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCT
GATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAA
CCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCA
ACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGG
ACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCT
ACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTG
GATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGC
ATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACG
TCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGT
GTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGA
AAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGG
ACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACA
TTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACG
ATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAG
ACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGACA
CGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAA
GTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAAT
AGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGG
ACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCT
GATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTT
TCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATT
ACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAA
CTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGA
CTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAG
CTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTC
ATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCAT
CACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAG
TGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAA
GGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGG
TGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTG
TACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGT
GTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTA
TACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATG
TACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCAC
AGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATA
TGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAA
CTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTA
GTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGA
CTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGC
TGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCT
GAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACT
TGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGC
CGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTAT
ATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTG
CATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACA
AACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACT
CCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTT
TAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCAT
GTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCA
GATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTC
ATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCT
TTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGC
GCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAG
ACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCAT
CAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCAC
CAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCT
GAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAAG
TGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATC
TATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAA
TATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCC
TGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCA
GTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTA
CCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTC
AAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGG
TTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACC
TAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACA
AGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGAC
AGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTAT
CAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAG
CTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCT
GTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACC
AGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCC
AAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCC
CAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAG
TGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGA
ATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTAC
TCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGC
AGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCC
CTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCT
GTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTAC
ATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTG
TCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCC
GTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTA
TCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGG
AGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATT
GAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTAT
CAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATG
GATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTG
GATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCT
CAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCA
TCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCC
TCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGT
CACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATC
TTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGT
GTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGA
GGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCA
ACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCAC
AGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCAC
GGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTC
AGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCA
ACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGG
CTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCA
TGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTC
TTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATG
GGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCA
GCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGG
CTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGT
CCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCT
GCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACC
AAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCAC
CTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCT
ACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTC
CAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCT
TACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGT
CTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGC
TACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGC
ATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACC
TGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCA
GCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATAT
TAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAA
ACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAAT
GTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAAT
AGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAG
AAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCC
TTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGA
CTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGG
GACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAA
AGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCG
GTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTC
CCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAG
ACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTA
CCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCT
TCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACA
AGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCC
AGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGC
AAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCT
GATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGC
CATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCC
CGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCA
AGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCAC
TGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCA
GACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTG
CAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATC
ATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCC
TGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGG
TGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTA
CCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTA
CCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCT
AGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTT
GAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTG
CCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAG
AGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACA
GGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGG
AATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCC
TGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCA
GCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACG
AAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAA
CAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGA
CCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCG
TCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAA
CCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGA
TATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCC
AGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCC
TGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCA
AGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGG
CCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTG
ACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCC
TTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTG
ACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGA
ACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAG
TGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGG
AGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTT
GTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGA
CCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGT
ATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAG
GATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGA
TTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGA
AAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTC
ACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGA
CTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACA
CGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGT
ATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAG
CTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGG
CACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTA
CAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGA
TGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATG
TTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGAT
GACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGT
ACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTT
TCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCT
GCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGA
TCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCA
ATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTT
GTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCG
TCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGA
CAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATT
GCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGT
GACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCA
ACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCC
TGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGT
GTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACG
GGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCC
CTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAA
ACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGG
CCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGT
TCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTT
GGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCT
TTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCC
ATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGT
GGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCA
GCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCT
GCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAG
TAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAA
AAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTG
GTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGAT
TGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCA
TTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTC
AAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCG
TACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTA
CCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACA
GTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGG
TTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGA
TGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACA
GACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCG
CCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGG
TCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCA
AACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAAT
CAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTG
ATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCT
TGTGATGATGACTACGATTATTACGATGATTATGATTATGAAGGATTCGG
GCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAA
CTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCT
GATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCAC
ATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGA
TTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGT
GATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAG
AGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGT
GCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTG
ACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTT
TACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAA
GAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGA
TTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTG
GAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGA
CACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGC
TCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCT
ATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCA
CTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCG
AACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTG
CGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGT
TCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGC
CAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTT
TGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACA
GGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCA
GTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACAC
CATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTG
TTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGC
TTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCG
GTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTG
AATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATC
TATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGAT
ACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGT
GGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCA
AGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACC
TGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTAC
TGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTA
ACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACAC
TACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACA
TATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCC
CTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGA
ATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGC
CGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTC
AGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCAC
TATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGA
CGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTAT
GATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAG
TGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCA
CCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCT
GAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGAT
CAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAA
TCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATT
AACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTC
CAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATC
CAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTG
ACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTC
TGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGG
AAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAG
ACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTT
GTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTG
CTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGA
AACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGG
AGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGA
ACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCC
TCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGAC
TTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACC
AGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAA
GGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATC
CTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGC
TTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGAT
GTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCA
GTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACA
GCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCA
AACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAG
CACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAG
GGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAAT
AACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGAT
GGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGA
TTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTAT
CTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAA
CCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTA
ATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCAC
TACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACAT
GTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCC
TCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATT
ACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTA
CAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGT
TCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATC
ATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGC
TGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTG
TCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGT
GATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCA
AGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGA
ACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCG
GACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCA
AACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCA
CGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATC
TAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAAT
CAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAA
CAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAA
CGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCAT
CCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATG
AAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAAC
ATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTG
CCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACA
GTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTAT
GAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGG
AAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGA
AAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGA
CATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGA
AGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAG
GGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTT
CCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCA
CAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGG
ACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTC
CAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGAC
ATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTT
ATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTG
ACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGC
TGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGC
AATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGT
CCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAA
TGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAG
TTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTAT
CAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATG
TCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAG
CAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATAC
CGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAA
GGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCC
CCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCT
GACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAA
TTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAG
CAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAG
ACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATA
TCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGA
ACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCG
TTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGT
CACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTG
ATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAA
CGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAA
TGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAAC
CTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAG
GGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTT
GATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATT
TCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAA
AGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAG
TTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTC
CCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGA
GAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAA
CTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTG
TCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTG
ACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCT
CCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGA
GCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATC
AGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGG
CCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAA
CCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTAC
AATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCT
TGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACG
GTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACT
TTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGC
AAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTG
GAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGT
GGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGT
GGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCAC
TGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCA
AATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGA
CCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGG
ATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGT
GTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGT
GGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTG
CATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTAT
TCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCT
GCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTG
ATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGC
CGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAAC
CAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCA
AGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAAC
AGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAA
TGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTG
GGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTT
GCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTT
GATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCC
TCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCAC
CTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCT
GGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCAT
TTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAA
GCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTC
TAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTA
TTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGA
CAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCT
GTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCA
TCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAA
GGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCAT
CGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCT
TCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTC
AACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAA
GGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCG
GCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCA
TCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCG
GAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCA
TGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATG
CAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCA
TGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGACA
ATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAG
GAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCC
AAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTA
TACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAG
CCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTT
AAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATG
ATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCA
GTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGAT
AGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACT
TTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATA
GGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATG
TGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATG
GAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATA
AATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGAT
GGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTAT
GCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGA
GAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTC
TATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAG
CAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGT
CTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAA
CCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTG
AGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAG
CAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGA
CAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAAT
TATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGC
AATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGA
AAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTC
TTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACC
TCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGC
TAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAG
TCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCC
AATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCA
AACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAA
AGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCT
GGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTAT
TGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCG
AAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTA
AATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACT
TCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTG
ACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAA
ATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGT
AACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACA
TCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCA
GAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCAT
ACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAG
TTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCA
GATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAA
ATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATC
TGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCC
AGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCA
GAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCA
AGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACT
GTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGAT
AACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTT
TCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGA
AGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATC
TGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACA
AGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCT
CCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATC
AACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTG
TGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACT
CAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCG
AAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGC
TGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACT
GAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTAT
CGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGG
GCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTT
GTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAG
TCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGT
TCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAA
AACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAG
CGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGG
TACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCT
TCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGA
AAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCT
ATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCC
GACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGG
TTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTA
TCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCC
TGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATG
TGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACC
TCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTT
GCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCT
AGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTC
GACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTT
ATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCAC
TGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGA
TGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGG
GCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCT
TCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCT
ATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAG
GGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACT
GTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGG
GCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAG
CAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGAT
CTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTAT
TCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGT
GTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATT
CAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTG
GAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCG
CGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATAC
GAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATG
TCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGA
AGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAATC
GGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATC
CACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTG
GCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACC
AGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGG
GACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCA
GAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGA
TTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAA
CGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTAC
AATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGT
GGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTG
AGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTC
ACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTG
GACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGT
ATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCA
GGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGG
AACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGAC
TGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGC
ACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGAT
AGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGT
ACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTA
ACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCA
GGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAG
TTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTG
TCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGT
GGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGT
TCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACA
AAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGA
CCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTAC
AGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTG
GCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAA
CAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTG
TCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAG
TTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACT
GGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTG
CATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGG
CCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCA
ACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAA
CGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACG
CTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCA
GTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTC
TGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCG
ACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCAT
ACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAG
GCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAAT
AGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGA
AAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGA
AGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGT
CAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGA
GGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCA
CAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTT
GTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGT
TCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTG
AGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCC
AGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAA
CTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGC
AAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCA
AAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGT
GCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAG
CTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTC
TTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATC
ATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATG
CGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCG
CGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGAC
AAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGA
TGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATT
CTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTC
AACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCT
ATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATC
CTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGC
GCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCC
GCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAA
CTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGA
GGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACC
AAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCA
TTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAG
TTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTC
CTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGT
AGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAG
ATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCA
GGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCA
ACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGA
GTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCT
TGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCA
ATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACT
TCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTAC
TGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCG
GTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGT
GTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGA
AAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTA
GCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGT
CCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTT
GCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGA
CTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCT
TACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTG
CGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGG
CTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTT
TTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCA
TCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTT
CTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAAC
CAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGG
AAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCT
AATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGT
GAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGG
TTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAAT
CATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGA
ATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACA
GGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATA
ACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGT
TGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTG
GTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGAT
GATGACTACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCAC
AATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTC
AGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGT
AACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTT
TGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAG
GGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTAT
AACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGC
TGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGG
TGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTG
GTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATC
AATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTA
CAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTA
TCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCA
GTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTA
ACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACT
GCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTT
CCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTAC
ACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGT
TCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTT
CAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAG
CTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGAC
TATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCG
GCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGC
CTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGC
TGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGT
GTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTG
AAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAA
CTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATT
GGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCG
AATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAG
CTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAG
TAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGG
GAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATC
GTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACA
ACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAG
AAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATG
AATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATT
GTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTG
CACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAA
GGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCT
TGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACC
TGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATA
CGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCAC
CTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGG
ATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCT
GTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGA
GATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGA
CGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATG
ACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGA
TTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAG
TAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTG
CAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGC
CCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACA
GTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTG
ACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGG
AGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTG
CTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGA
GTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAA
ACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAG
ACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATC
AGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGA
GAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTG
AAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGA
ATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAA
CCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTG
GAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGT
GAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCAT
CCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGAT
CAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAA
GTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAA
CCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGG
TTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCA
GTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGT
GAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAG
GGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGG
GTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACAT
CTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGA
TTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTA
TTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTG
CCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCA
CCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTC
CTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCT
GGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGG
CAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTG
GTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAG
CACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGT
TACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTT
ATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCC
CGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGG
TGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGA
AGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATT
CTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTT
GGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATG
TATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGA
GTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGG
AGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATCA
GCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACC
TTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAA
CGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTATC
AAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCA
AAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTT
CCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTA
CTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATT
ACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGC
AGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATGAAGGA
TTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGT
GACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTG
TGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTAC
TCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGA
GGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTC
CCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAAC
CAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGT
CAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCA
CTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGT
CTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGG
GACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGA
AAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTT
GACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGA
GGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTT
TCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTG
GACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAA
CATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGA
ACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGA
AACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAG
GGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGAT
CATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAA
TGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCT
CTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCAC
CTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGC
AACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATAC
CTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGG
CCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAG
AACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGA
ATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAA
GCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCA
TGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGAT
ACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCA
GGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCA
GAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCT
GGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGA
ACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCA
AACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGG
ATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTG
AGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTAT
TCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGT
TGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTG
AGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACC
GTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCA
GTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCA
GGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGT
TCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGA
AGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCA
CCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACA
GAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGT
ATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGA
ACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGT
ATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGT
GGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAA
CAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCA
AGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAA
CACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTT
TTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTG
GACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGA
GGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGA
TAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACA
ACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGAT
AATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAG
CTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAAT
CTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAAC
TTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCC
TCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGAC
TCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGG
AGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAA
CAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTG
TTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGT
CAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATC
TCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACA
AACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGG
AGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTG
ACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTT
TTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAG
TAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCA
CCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTC
ATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGG
CATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTAC
TGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTC
AACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATT
TCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCA
TCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAG
ACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTT
CGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGT
ATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGA
GTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCAT
CGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGA
TCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCC
CTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGT
CCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTC
CTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCC
AACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAG
CAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACA
GCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGC
ATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACAC
AGAAACAAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCAT
TAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAG
ATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGG
TTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTG
GTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACG
GTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGC
CTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATG
ATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAA
GAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGC
AAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCA
CCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCC
TCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGC
CACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAG
TTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGT
GTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTC
TGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGG
ATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAG
GTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGT
GCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCT
CGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGA
GAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGA
TGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTA
GTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGA
CAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTAC
ACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGA
CCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGA
CGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGG
CGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATA
AATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCA
GTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGG
CGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATA
TTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACT
GGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCT
GACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGC
GGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTT
GGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACA
ACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGC
AATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTC
AACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCG
CCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCA
TCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTAT
CGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAAT
TGAACCTGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACAG
AAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATA
CAGTTGATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAA
TGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCC
AACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGA
GACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTT
CGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTA
TCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGAT
TATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGG
TGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCA
AGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACA
GTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGC
CAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGA
ACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTT
CAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCAT
TGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACC
TCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGT
TCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATG
TTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCC
TGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGG
TGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTG
CATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGG
ACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGT
AATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGG
ATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACA
TCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCT
GTCGACCAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGT
TATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATG
ATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATT
GGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGG
CTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGAT
CTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATA
GCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATAT
ACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGA
GCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACA
AAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGA
ACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTG
AGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGAC
TTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTT
TGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCA
ACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTG
GACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCT
CACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCAC
AGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATC
TTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGT
GGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCA
TTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACAC
GTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTT
TGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTG
ATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAAC
CAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAA
CACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGA
CTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTA
CGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGG
ATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCA
TCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGT
CAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTG
TTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAA
AGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGA
CATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACAT
TCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCTGAATGTCACGA
TAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAGCAAGAAGAAGA
CGCCATGACACAGAAACAAAAACGACAGACAATCATATTAAATCGGACAC
GGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAACAATCCACAAG
TGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATGTGCTGGCAATA
GTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATAGAACCAGTGGA
CGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGAAGAGGGACCTG
ATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCTTCGCAGAGTTT
CAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGACTACGATTATTA
CGATGATTATGATTATGAAGGATTCGGGCCCACAATGGGACCAACGGAAC
TTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAAGGTACAATGAC
TGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGGTGTGTGGGAGC
TGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCCCCCTGAGGTCA
TCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGACTGTCACCATC
ACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCTGTGGACAGT
GGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTTCAGGTATGAAG
GCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGT
GAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCAGAAGGAACTGT
ACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCAAGGACTGTGTG
TCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTGATGGCACTTAT
ACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCCATGATAGATGT
ACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCCGGTGTACCACA
GTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAAGAGTAACATAT
GACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACTGGGCAGGTAAC
TGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAGACAAGTTGTAG
TTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGCAGTTGTCTGAC
TCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCATGCGTGGGGCT
GAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCTGGAGTTCCCTG
AAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGTGGACAAAACTT
GCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTACCTGGACCAGCC
GTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTACCCTACAGTATA
TCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGC
ATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTGAGGAACAACAA
ACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGCCTCTGTCACTC
CAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGAGAGAGTTCTTT
AACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAGGGACTGGCATG
TACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGAATGTGCATCAG
ATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCTGTTGGCCGTCA
TTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAGCTTCAACTCTT
TGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGAAGCAACGGGCG
CAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAACAAACGCTCAGA
CCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGACCGTCAGTCATC
AGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGTCAGTCTGCACC
AAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAACCGCCGACCCTG
AATGTAACAATTGAACCTGTGAACGTAACGATGAATGATATCATACAAGT
GAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCAGATAGGCATCT
ATCCAGAAATACAGTTGATGGGATACATATTTGCACCCTGCAATAGGAAT
ATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCT
GTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGCCAGGAAGGCAG
TGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGACTAGTCAGTAC
CAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCTTCAGAGGTTCA
AGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGACGCCACAGGGT
TTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAACAGTTGTACCT
AACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGTGGTGTTCACAA
GGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGAGTCTGAGGACA
GCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTGTTTCCAGTATC
AGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGACCCAAACTCAGC
TGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTATCAGCAAGCTG
TGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGGATGCAAAACCA
GGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGATTCTGTGCTCCA
AGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAAAACAGCTGCCC
AGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCACACTCTTAAGT
GCATCAACATGTTACGGTGAAACAGTGACTGTGACAGACTCATCATCGAA
TCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACACGCATGCGTACT
CTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTATTCCGCGGGCA
GTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGCTGGACAAGCCC
TGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGCACAGATGCCTG
TTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTACAGATTCTTACA
TCTATCGGAGGATCACTGACGATAGGAAACATCAGAGATGCCTCAACTGT
CCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGTTGGCTATTCCG
TGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATGACATCCTTTAT
CAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTACAGGCGCTGGA
GCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTTCCGCCGCATTG
AACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTGCAGAACTTATC
AACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGATCTAGAGGATGG
ATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAATGACCAAGTGG
ATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTGTTGCATTTCTC
AAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGTCTGAGTTTCAT
CATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGACAGCTCCTTCCT
CAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTGCCAGTAGAGTC
ACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTGACAAGATATCT
TCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAACATCAGGTGTG
TTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAG
GGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTGTGTGAGTGCAA
CCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGGGGGCTTGCACA
GCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCCTGTCAATCACG
GGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAACAACTTCGTCA
GACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGCCCTACTGGCAA
CTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTTCTCCGGTCGGC
TGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTGGCTGTGTTCAT
GTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTTTGTGAAAGTCT
TGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCATTTTAGCATGG
GGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTGGACGTCCCCAG
CACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAGCTTTTGCTGGC
TGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTGCTGGACTGGTC
CTACTGTTCAACACCATCGTGTATATCATGGTTATCAGTAAGCTTACCTG
CAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAAAGGTGCGACCA
AGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGGTCGGGCTCACC
TGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATTGTCTTTTCCTA
CTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCATTTTCATCTTCC
AGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTT
ACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGTACAACCAAGTC
TTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTACCGCGGAAGGCT
ACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAGTGCCTAATGCA
TATACGAACATTCCCATGAACAGCATCTAATCAGCAGGTTTGGTGAACCT
GAATGTCACGATAATGCAGCGCATAATCAAACCTTTGATGGAGGTTCCAG
CAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAGACAATCATATT
AAATCGGACACGGACAATCCATTAAAACGTATCAAGCGCCAAGAATTAAA
CAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGTCTACAGGAATG
TGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAAACATAACAATA
GAACCAGTGGACGTTATACCTGGTAACATGTTACTAATCAAAGTTGCAGA
AGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGATGTTGGTGCCT
TCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTTGTGATGATGAC
TACGATTATTACGATGATTATGATTATGAAGGATTCGGGCCCACAATGGG
ACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAACTTGTCAGCAAA
GGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTGATGGTAACCGG
TGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACATGTTTTGTTCC
CCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGATTGTAGGGGAGA
CTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTGATTATAACTAC
CTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGAGATGCTGTCTT
CAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTGCAGGGTGACAA
GTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACTGTGGTCCCA
GAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTTACATCAATGCA
AGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAGAGCTACAGCTG
ATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGATTTCTATCAGCC
ATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGGAATCAGTTCCC
GGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGACACTTAACGCAA
GAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCTCAACTGCCACT
GGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTATTGTTCCCCAG
ACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCACTCTACACCTGC
AGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGAACTGTTCATCA
TGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGCGACTTCAGCCT
GGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTTCCAAGCTTGGT
GGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCCAAGACTATTAC
CTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTTGTTCGGCCTAC
CCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAGGCAGCCTGCTA
GGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAGTACGCTGGTTG
AGGAACAACAAACCAGTCAATATTTCTGACAGCAACACCATCGTGTTTGC
CTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGTTATTGAAGAGA
GAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCTTGGAACTACAG
GGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGGTTATTGGGGGA
ATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGAATTCGAATCCT
GTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCTATCAGCTGCAG
CTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATACGGAGTAACGA
AGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTGGCTGGGAAAAC
AAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAAGAATCGTTGAC
CGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCTGAACAACCCGT
CAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACTGACAGAAGAAC
CGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAACGATGAATGAT
ATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACTACATTGTGCCA
GATAGGCATCTATCCAGAAATACAGTTGATGGGATACATATTTGCACCCT
GCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCCTCCAAGGTCAA
GAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAATGGCTTGTGGC
CAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCCGGACCTGGTGA
CTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCAGCATACGCCCT
TCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACTATCACCTGTGA
CGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGACGGTGGATGGAA
CAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATGATGCTGTAAGT
GGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGTGGTGAGATGGA
GTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCACCATGACGTTTG
TTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTGAGATGACAGAC
CCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATCAAGGATTGGTA
TCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAATCAGAGTAAAGG
ATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTAACGTGCAGGAT
TCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCCAATGCCCTGAA
AACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCCAAACAGTGTCA
CACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGACTGTGACAGAC
TCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCTGCAGGAGACAC
GCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGAAAGTGCTGGTA
TTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGACTGGAGTCAGC
TGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTGTCCAAACTGGC
ACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGCTGCAGACTTAC
AGATTCTTACATCTATCGGAGGATCACTGACGATAGGAAACATCAGAGAT
GCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGAGATGAGAATGT
TGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAACATTGAAGATG
ACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCTCCAGAATCGTA
CAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACTTCAAACCGTTT
CCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCAGATTGGAGCTG
CAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAGGCAGTGAAGAT
CTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCCTTCATCCCCAA
TGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCTTGGATCAGTTG
TTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATGTGGAAGTCCGT
CTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAGTCCAACCAGAC
AGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAGCAGGGTTATTG
CCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAAACCCAGTGGTG
ACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGCACAGTGAGCAA
CATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGGGGGAGGGGCCT
GGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATAACAGGGTGGTG
TGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATGGACATCTACGG
GGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGATTGGGATTGCCC
TGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATCTGGTATTCAAA
CAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAACCTGTGCCTGGC
CCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAATGCCACCAGTT
CTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACTACTTCCTCTTG
GCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATGTACCTGGCCTT
TGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCTCAAGGCAGCCA
TTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTACCCTGGTTGTG
GACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTACAGGAGCACCAG
CTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTTCCTGTTACCTG
CTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCATGGTTATCAGT
AAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCTGATCCCGGAAA
AGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGTCATGGTGCTGG
TCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTGATGGAAGGATT
GTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAAGGATTCTTCAT
TTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAACCTTTGGTTCA
AGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGGACATGTATCGT
ACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAAACTGAGTCTAC
CGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCACGCCGGAGACAG
TGCCTAATGCATATACGAACATTCCCATGAACAGCATCTAATCAGCAGGT
TTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATCAAACCTTTGAT
GGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAACAAAAACGACAG
ACAATCATATTAAATCGGACACGGACAATCCATTAAAACGTATCAAGCGC
CAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATCCACCAAAGGGT
CTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGAAGTTTCCGCAA
ACATAACAATAGAACCAGTGGACGTTATACCTGGTAACATGTTACTAATC
AAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGCCAATTACGTGA
TGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAGTTTGCAGCCTT
GTGATGATGACTACGATTATTACGATGATTATGATTATGAAGGATTCGGG
CCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGAAATGTGACAAC
TTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAAAGCTGTGCCTG
ATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGACATTACTCCACA
TGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAAGCTGAGGTGAT
TGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGGGTTTCCCAGTG
ATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTCCTAACCAGAGA
GATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCACAAGGTCAAGTG
CAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGACAGCACTGTGA
CTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCCAGAGTCTGTTT
ACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACATTTGGGACAAG
AGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTATCAGAAAGGAT
TTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGACAGTTGACTGG
AATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCTGGAGAGGGGAC
ACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCAATCTTTCAGCT
CAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTCCAGTGGACCTA
TTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAATGTGAACATCAC
TCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGTTGTGAACCCGA
ACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATCAGGGAAACTGC
GACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGTCTGAGGGCGTT
CCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGCAGGATCATGCC
AAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACCGTAAATGCTTT
GTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAGGCCCTCTACAG
GCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCCCCCACCTTCAG
TACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTGACAGCAACACC
ATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAATTATACCTGTGT
TATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGCAACGGCCAGCT
TGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGACTGAGAACCGG
TTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATATCTCGAATCTGA
ATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAACACAAGCATCT
ATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGTTACCATGGATA
CGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTCACGATACTGTG
GCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGATGTCAGGTCAA
GAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAACGTGCAGAACCT
GAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAATGTGCTGGTACT
GACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACCTGTGAACGTAA
CGATGAATGATATCATACAAGTGAACATCACAGAAGAGGGGTCAAACACT
ACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTGATGGGATACAT
ATTTGCACCCTGCAATAGGAATATCATACCAAATGATTTCAGTGAGTCCC
TCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAAGGTATTCTGAA
TGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGTTGTGTTGGGCC
GGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCCCCCTGAGGTCA
GCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAGAGACCGTCACT
ATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAACTACCAGTGGAC
GGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGTCTTCAGGTATG
ATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGACAAGTTCAAGT
GGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTCCCAGAAGGCAC
CATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAGCTTCACCCCTG
AGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCAGTACAGAGATC
AAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGCCAGGTATCAAT
CAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAACCCAGAACATTA
ACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACAATGGTATCTCC
AATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTTGGGGTGGATCC
AAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGGTGAAACAGTGA
CTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTTTCCCAAGCTCT
GCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCAAACAACACGGA
AAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGGAAGTTTTGAGA
CTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTGGGCTGGACTTG
TCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTGGCAGAGGTTGC
TGCAGACTTACAGATTCTTACATCTATCGGAGGATCACTGACGATAGGAA
ACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAAATACAACTGGA
GATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGACCAGATAATGAA
CATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGATCAAGCTCCCT
CCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTGTCAATCTGACT
TCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTGGAAACTTACCA
GATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGCATCCCTCGAAG
GCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATTCTGACTCATCC
TTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTGCCTGGAGAGCT
TGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGATCCAACAGATG
TGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCCGGTTGTTCCAG
TCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACCAGGGTCAACAG
CAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAAGAATCTCCCAA
ACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACAGTACAAACAGC
ACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAATGCTGGAGGAGG
GGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGGGATTGACAATA
ACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTGCTGTTTTGATG
GACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTGATCAGTAAGAT
TGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCTCATCACCTATC
TGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACCTCCTCATCAAC
CTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTGGCAGGCATTAA
TGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATTTCTACTGCACT
ACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAGCCTTCAACATG
TACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCTAGATTTCTCCT
CAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTATTGCCATCATTA
CCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGACAGGAGACCTAC
AGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTGTACTTCGGGTT
CCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCATCGTGTATATCA
TGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAGGGAGAGTTGCT
GATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATCGCCATCGCTGT
CATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTTCATGATCAGTG
ATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCAACTCCCTGCAA
GGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAGGAAGTCCAGAA
CCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGGCTGTCCTGCGG
ACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCATCGTCCAACCAA
ACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGGAAAAGCAGCAC
GCCGGAGACAGTGCCTAATGCATATACGAACATTCCCATGAACAGCATCT
AATCAGCAGGTTTGGTGAACCTGAATGTCACGATAATGCAGCGCATAATC
AAACCTTTGATGGAGGTTCCAGCAAGAAGAAGACGCCATGACACAGAAAC
AAAAACGACAGACAATCATATTAAATCGGACACGGACAATCCATTAAAAC
GTATCAAGCGCCAAGAATTAAACAATCCACAAGTGCAGGAAGAGATCATC
CACCAAAGGGTCTACAGGAATGTGCTGGCAATAGTCCCAAACGGTTATGA
AGTTTCCGCAAACATAACAATAGAACCAGTGGACGTTATACCTGGTAACA
TGTTACTAATCAAAGTTGCAGAAGAGGGACCTGATAAGCCAACGGTTTGC
CAATTACGTGATGTTGGTGCCTTCGCAGAGTTTCAGTTAAGAGCCTACAG
TTTGCAGCCTTGTGATGATGACTACGATTATTACGATGATTATGATTATG
AAGGATTCGGGCCCACAATGGGACCAACGGAACTTCCAGTTCAAGAGGGA
AATGTGACAACTTGTCAGCAAAGGTACAATGACTGGATAGTTGCAAGGAA
AGCTGTGCCTGATGGTAACCGGTGTGTGGGAGCTGACTTTGTCACCCGAC
ATTACTCCACATGTTTTGTTCCCCCTGAGGTCATCATAGGCCCCTCGGAA
GCTGAGGTGATTGTAGGGGAGACTGTCACCATCACATGTGACGCCACAGG
GTTTCCCAGTGATTATAACTACCTGTGGACAGTGGATGGAACAGTTGTTC
CTAACCAGAGAGATGCTGTCTTCAGGTATGAAGGCATAAATGGTGTTCAC
AAGGTCAAGTGCAGGGTGACAAGTTCAGGTGGTGAGATGGAGTCTGAGGA
CAGCACTGTGACTGTGGTCCCAGAAGGAACTGTACTATGCAGGGATGTCC
AGAGTCTGTTTACATCAATGCAAGGACTGTGTGTCAGAGAAGAGGTGACA
TTTGGGACAAGAGCTACAGCTGATGGCACTTATACTTCTATTGTGCCTTA
TCAGAAAGGATTTCTATCAGCCATGATAGATGTACAAGCAACCTCGGTGA
CAGTTGACTGGAATCAGTTCCCGGTGTACCACAGTAGTCTCAGAGAAGCT
GGAGAGGGGACACTTAACGCAAGAGTAACATATGACAACCTGGATGGGCA
ATCTTTCAGCTCAACTGCCACTGGGCAGGTAACTGCTGAGACTAGTGGTC
CAGTGGACCTATTGTTCCCCAGACAAGTTGTAGTTCAGCAGGGACAGAAT
GTGAACATCACTCTACACCTGCAGTTGTCTGACTCAGACAGTACACCAGT
TGTGAACCCGAACTGTTCATCATGCGTGGGGCTGAAATTATGGACCTATC
AGGGAAACTGCGACTTCAGCCTGGAGTTCCCTGAAAGCAATGGACGATGT
CTGAGGGCGTTCCAAGCTTGGTGGACAAAACTTGCAGAAAGGGGCGGAGC
AGGATCATGCCAAGACTATTACCTGGACCAGCCGTTTCTTGATAAATACC
GTAAATGCTTTGTTCGGCCTACCCTACAGTATATCACCTCACCAGTAAAG
GCCCTCTACAGGCAGCCTGCTAGGCTGGCGTGCATTGCTAGCGGCGGCCC
CCCACCTTCAGTACGCTGGTTGAGGAACAACAAACCAGTCAATATTTCTG
ACAGCAACACCATCGTGTTTGCCTCTGTCACTCCAGCCAATACTGGAAAT
TATACCTGTGTTATTGAAGAGAGAGAGTTCTTTAACCAAACTCTGACAGC
AACGGCCAGCTTGGAACTACAGGGACTGGCATGTACAAAGTTGCGGCAGA
CTGAGAACCGGTTATTGGGGGAATGTGCATCAGATGCTGGTTTTGGATAT
CTCGAATCTGAATTCGAATCCTGTTGGCCGTCATTTATTGCACAACAGAA
CACAAGCATCTATCAGCTGCAGCTTCAACTCTTTGTCGAAGGGCAATCGT
TACCATGGATACGGAGTAACGAAGCAACGGGCGCAGTAAATCTCAACGTC
ACGATACTGTGGCTGGGAAAACAAACGCTCAGACCACTTCGTCGCCGTGA
TGTCAGGTCAAGAATCGTTGACCGTCAGTCATCAGCTGACCGCATCAAAC
GTGCAGAACCTGAACAACCCGTCAGTCTGCACCAAAAAATTTATCGAAAT
GTGCTGGTACTGACAGAAGAACCGCCGACCCTGAATGTAACAATTGAACC
TGTGAACGTAACGATGAATGATATCATACAAGTGAACATCACAGAAGAGG
GGTCAAACACTACATTGTGCCAGATAGGCATCTATCCAGAAATACAGTTG
ATGGGATACATATTTGCACCCTGCAATAGGAATATCATACCAAATGATTT
CAGTGAGTCCCTCCAAGGTCAAGAGGAAAGCCTGTCAGTTTGCCAACAAA
GGTATTCTGAATGGCTTGTGGCCAGGAAGGCAGTGCCAGATGGAGACAGT
TGTGTTGGGCCGGACCTGGTGACTAGTCAGTACCAGAAATGTTTCGTTCC
CCCTGAGGTCAGCATACGCCCTTCAGAGGTTCAAGATCTGGTTATCGGAG
AGACCGTCACTATCACCTGTGACGCCACAGGGTTTCCCAGTGATTATAAC
TACCAGTGGACGGTGGATGGAACAGTTGTACCTAACCAGAGAGGTGCTGT
CTTCAGGTATGATGCTGTAAGTGGTGTTCACAAGGTCAAGTGCAAGGTGA
CAAGTTCAAGTGGTGAGATGGAGTCTGAGGACAGCACTGTGACAGTGCTC
CCAGAAGGCACCATGACGTTTGTTTCCAGTATCAGGATAACTGCCAGGAG
CTTCACCCCTGAGATGACAGACCCAAACTCAGCTGCTTTCCAGAACATCA
GTACAGAGATCAAGGATTGGTATCAGCAAGCTGTGGGAAGTGTTCAGGGC
CAGGTATCAATCAGAGTAAAGGATGCAAAACCAGGATCTGTCATTGCAAC
CCAGAACATTAACGTGCAGGATTCTGTGCTCCAAGACAAGGACCTCTACA
ATGGTATCTCCAATGCCCTGAAAACAGCTGCCCAGTCTCCGAGTTCTCTT
GGGGTGGATCCAAACAGTGTCACACTCTTAAGTGCATCAACATGTTACGG
TGAAACAGTGACTGTGACAGACTCATCATCGAATCGTGTGACCCTGACTT
TCCCAAGCTCTGCAGGAGACACGCATGCGTACTCTACTCAAAGGTGTGCA
AACAACACGGAAAGTGCTGGTATTCCGCGGGCAGTTCGAAGGTGCATTGG
AAGTTTTGAGACTGGAGTCAGCTGGACAAGCCCTGAGCTGCTGGACTGTG
GGCTGGACTTGTCCAAACTGGCACAGATGCCTGTTACTGAAGGTAATGTG
GCAGAGGTTGCTGCAGACTTACAGATTCTTACATCTATCGGAGGATCACT
GACGATAGGAAACATCAGAGATGCCTCAACTGTCCTGGGCAACATCGCAA
ATACAACTGGAGATGAGAATGTTGGCTATTCCGTGGTTGTGTCTGTCGAC
CAGATAATGAACATTGAAGATGACATCCTTTATCAGAGTCAAGTTATGGA
TCAAGCTCCCTCCAGAATCGTACAGGCGCTGGAGCAGTTCAATGATCGTG
TCAATCTGACTTCAAACCGTTTCCGCCGCATTGAACAAAACATTGGGGTG
GAAACTTACCAGATTGGAGCTGCAGAACTTATCAACAGCGTTGGCTTTGC
ATCCCTCGAAGGCAGTGAAGATCTAGAGGATGGATTGGTACGATCTTATT
CTGACTCATCCTTCATCCCCAATGACCAAGTGGATGCTTCCATAGCTCTG
CCTGGAGAGCTTGGATCAGTTGTTGCATTTCTCAAGGAAAATATACCTGA
TCCAACAGATGTGGAAGTCCGTCTGAGTTTCATCATCTATCAGAGCAGCC
GGTTGTTCCAGTCCAACCAGACAGCTCCTTCCTCAGCCGACACAAAAACC
AGGGTCAACAGCAGGGTTATTGCCAGTAGAGTCACTGGTTTTGAACTCAA
GAATCTCCCAAACCCAGTGGTGACAAGATATCTTCCTATCGTTGAGAACA
GTACAAACAGCACAGTGAGCAACATCAGGTGTGTTTCCTGGGACTTCAAT
GCTGGAGGAGGGGGAGGGGCCTGGTCAACAGAGGGATGTGACTTTGTTGG
GATTGACAATAACAGGGTGGTGTGTGAGTGCAACCACCTCACCAACTTTG
CTGTTTTGATGGACATCTACGGGGGCTTGCACAGCTTTGCGCTGGACTTG
ATCAGTAAGATTGGGATTGCCCTGTCAATCACGGGCCTAGTCCTCACCCT
CATCACCTATCTGGTATTCAAACAACTTCGTCAGACTCGACCACAGCACC
TCCTCATCAACCTGTGCCTGGCCCTACTGGCAACTCTTATCATCTTCCTG
GCAGGCATTAATGCCACCAGTTCTCCGGTCGGCTGCACTGTCGTGGCATT
TCTACTGCACTACTTCCTCTTGGCTGTGTTCATGTGGATGGCCATTGAAG
CCTTCAACATGTACCTGGCCTTTGTGAAAGTCTTGGGGGCACACGTGTCT
AGATTTCTCCTCAAGGCAGCCATTTTAGCATGGGGTCTTCCCTTTGTTAT
TGCCATCATTACCCTGGTTGTGGACGTCCCCAGCACCTATCCTGATGGAC
AGGAGACCTACAGGAGCACCAGCTTTTGCTGGCTGCAGGGTAACCAGCTG
TACTTCGGGTTCCTGTTACCTGCTGGACTGGTCCTACTGTTCAACACCAT
CGTGTATATCATGGTTATCAGTAAGCTTACCTGCAGGGGCAGGACTAAAG
GGAGAGTTGCTGATCCCGGAAAAGGTGCGACCAAGCAGCAGCTACGCATC
GCCATCGCTGTCATGGTGCTGGTCGGGCTCACCTGGATCTTTGGATTCTT
CATGATCAGTGATGGAAGGATTGTCTTTTCCTACTTATTCTGCATCTTCA
ACTCCCTGCAAGGATTCTTCATTTTCATCTTCCAGTGTGTACGTCAAAAG
GAAGTCCAGAACCTTTGGTTCAAGGTTCTCCTTACATTCAGGTGTTGCGG
CTGTCCTGCGGACATGTATCGTACAACCAAGTCTTCTGGAGGAAAGTCAT
CGTCCAACCAAACTGAGTCTACCGCGGAAGGCTACTCGCGTGGACATCGG
AAAAGCAGCACGCCGGAGACAGTGCCTAATGCATATACGAACATTCCCAT
GAACAGCATCTAA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97387gene:BL97387Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97387_cuf5transcript:BL97387_cuf5-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97387_cuf5-E1BL97387_cuf5-E1-1564476830-186519Branchiostoma lanceolatumexon
BL97387_cuf5-E2BL97387_cuf5-E2-1564476830-186516Branchiostoma lanceolatumexon
BL97387_cuf5-E3BL97387_cuf5-E3-1564476830-186514Branchiostoma lanceolatumexon
BL97387_cuf5-E4BL97387_cuf5-E4-1564476830-186512Branchiostoma lanceolatumexon
BL97387_cuf5-E5BL97387_cuf5-E5-1564476830-186510Branchiostoma lanceolatumexon
BL97387_cuf5-E6BL97387_cuf5-E6-1564476830-186508Branchiostoma lanceolatumexon
BL97387_cuf5-E7BL97387_cuf5-E7-1564476830-186506Branchiostoma lanceolatumexon
BL97387_cuf5-E8BL97387_cuf5-E8-1564476830-186504Branchiostoma lanceolatumexon
BL97387_cuf5-E9BL97387_cuf5-E9-1564476830-186502Branchiostoma lanceolatumexon
BL97387_cuf5-E10BL97387_cuf5-E10-1564476830-186500Branchiostoma lanceolatumexon
BL97387_cuf5-E11BL97387_cuf5-E11-1564476830-186498Branchiostoma lanceolatumexon
BL97387_cuf5-E12BL97387_cuf5-E12-1564476830-186496Branchiostoma lanceolatumexon
BL97387_cuf5-E13BL97387_cuf5-E13-1564476830-186494Branchiostoma lanceolatumexon
BL97387_cuf5-E14BL97387_cuf5-E14-1564476830-186492Branchiostoma lanceolatumexon
BL97387_cuf5-E15BL97387_cuf5-E15-1564476830-186490Branchiostoma lanceolatumexon
BL97387_cuf5-E16BL97387_cuf5-E16-1564476830-186488Branchiostoma lanceolatumexon
BL97387_cuf5-E17BL97387_cuf5-E17-1564476830-186486Branchiostoma lanceolatumexon
BL97387_cuf5-E18BL97387_cuf5-E18-1564476830-186484Branchiostoma lanceolatumexon
BL97387_cuf5-E19BL97387_cuf5-E19-1564476830-186482Branchiostoma lanceolatumexon
BL97387_cuf5-E20BL97387_cuf5-E20-1564476830-186480Branchiostoma lanceolatumexon
BL97387_cuf5-E21BL97387_cuf5-E21-1564476830-186478Branchiostoma lanceolatumexon
BL97387_cuf5-E22BL97387_cuf5-E22-1564476830-186476Branchiostoma lanceolatumexon
BL97387_cuf5-E23BL97387_cuf5-E23-1564476830-186474Branchiostoma lanceolatumexon
BL97387_cuf5-E24BL97387_cuf5-E24-1564476830-186472Branchiostoma lanceolatumexon
BL97387_cuf5-E25BL97387_cuf5-E25-1564476830-186470Branchiostoma lanceolatumexon
BL97387_cuf5-E26BL97387_cuf5-E26-1564476830-186468Branchiostoma lanceolatumexon
BL97387_cuf5-E27BL97387_cuf5-E27-1564476830-186466Branchiostoma lanceolatumexon
BL97387_cuf5-E28BL97387_cuf5-E28-1564476830-186464Branchiostoma lanceolatumexon
BL97387_cuf5-E29BL97387_cuf5-E29-1564476830-186462Branchiostoma lanceolatumexon
BL97387_cuf5-E30BL97387_cuf5-E30-1564476830-186460Branchiostoma lanceolatumexon
BL97387_cuf5-E31BL97387_cuf5-E31-1564476830-186458Branchiostoma lanceolatumexon
BL97387_cuf5-E32BL97387_cuf5-E32-1564476830-186456Branchiostoma lanceolatumexon
BL97387_cuf5-E33BL97387_cuf5-E33-1564476830-186454Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000034genomeSc0000034:1201381..1221080 -
Properties
Property NameValue
Transcript idBL97387_cuf5
Biotypeprotein_coding