Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97354_cuf9 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97354_cuf9
Unique Nametranscript:BL97354_cuf9
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97354_cuf9

>transcript:BL97354_cuf9-protein ID=transcript:BL97354_cuf9-protein|Name=transcript:BL97354_cuf9|organism=Branchiostoma lanceolatum|type=polypeptide|length=312bp
PPAHGTISSVTAPSAGTWNSLQCDTAVVNQGPVHTVNCGTDSTNFNGQTF
TVSCPVGCSGCTGCVWGSGVYTVDSSICFAAIHDGRITNAGGQVTVHRWP
GQSSYHGSWQNGIQSRDYGHWGSSFAFTPGNREQKSSTTTCASSGYTSFN
GICYKAYSRNKSYNQARQVCAADGGFLAMPKDAASNDYINQLCGGDCWIG
LNEQSVEDRWQWEDGSILSAAGFSNWARRARNHHAGGRSGSGSNSGSGSG
NKDDNKDCALLKQSGPKWEEHDCGHGHHFVCQSNHVIHSQVQTQCTVLAN
PDPISQGSVTGP
Run BLAST on NCBI

mRNA from alignment at Sc0000091:636250..638730-

Legend: polypeptideexonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97354_cuf9 ID=transcript:BL97354_cuf9|Name=transcript:BL97354_cuf9|organism=Branchiostoma lanceolatum|type=mRNA|length=2481bp|location=Sequence derived from alignment at Sc0000091:636250..638730- (Branchiostoma lanceolatum)
CCTCCAGCTCATGGGACCATCAGTAGTGTAACAGCTCCCTCTGCCGGTAC CTGGAACTCACTGCAGTGCGATACCGCCGTGGTAAACCAAGGCCCGGTCC ATACCGTGAACTGTGGTACTGACTCCACCAACTTCAACGGCCAAACCTTC ACGTAAGACACATGACATATAATGTTAAACCCAATATACTATTGATATCT AAACAGTCTTCTACAAAATGAAAAAGAAACTCACTGAATTCTTTGTCTCA ATTACAACCTTCGTCAGGTTCAACTTACCAACAAGCGGGACGCCTGATCT TAGAAATACGTGACGTACAAATTAGTCAAAGGTACAAGGAAGTCTATACC GCCCCTCGTCTTTGTTTGATAAACGACGCAGATTGTATACCCACGACAGC GTTTTTATTGATACATTATGGCTTTTAATGTCTCTAAAGGTTTCTCTCAA ATCATTTTGCAAAATTAGTCAATTGTTAGACCCAACTTTCCCTCCATTTT ACAGCGTCAGTTGTCCTGTTGGGTGCTCTGGGTGCACTGGTTGTGTCTGG GGGTCTGGTGTCTACACGGTCGTGAGTATTATACTTCTGGATACTGGAAA CTACATTTGTAAACGGATACTTCAGTAACTGTTCCTCATAGTTGTTAACA ATTTAGACATTTCTCAGTGTAAACTGTGCAAGAAATGCACATTTTTTGGG GGGTAGCGGGAGGCACTGATGAATGATGCTGCTCTTTGGCAGGATTCGAG TATTTGCTTTGCTGCTATCCATGACGGAAGGATCACGAATGCTGGCGGAC AGGTGACTGTGCACAGATGGCCCGGACAGAGCTCGTACCACGGATCCTGG CAAAACGGCATCCAATCGAGGGAGTAAGTGACATATAGGGGTACATGTAC ATCAACATTTGCTGCAAATATGACTTTGTAAGGACTAAATTCATCTTGCT AACGACGTGCTAGTCTGAATATTCTCTGAAGATAAACGTGCTCTCCATCT TTTTTTCCAGTTATGGACACTGGGGCAGTTCCTTCGCCTTTACACCAGGT AGCTCAACAGTTTACACTTGTTGACTGCTTTGAAATAAATGCTAAGTTTA AAACGTTAGTTGTTGCTGAAAGAATGACGGAGGTACAAAGTCTCGGTTCT CTATCTCAGTTTGAAGATATTTCCAAAAGAGCTCATTAGATGAGGACCAT AAGATAACCATACCACCCTTGCTATAGTTCTTTTGTGTATTGTTTATACT TCAGCGTAGTTAAGTTTCAACCTTAAGCTAACTCTTCTAACTCTAAACAT TGTAACAACCGTGTTATAGTCCTGAAACCATAATATGTTTTGATGTTGCA AAATCCAGAATGATACAACAACACTCCACTGTTCTTTTACCGATAGGTAA CAGAGAACAAAAGTCGTCAACTACTACCTGCGCTTCATCAGGCTACACCA GTTTCAACGGGATCTGCTACAAGGCCTACAGCCGAAACAAGAGCTACAAC CAGGCCAGACAAGTTTGTGCCGCAGACGGCGGGTTCTTAGCCATGCCGAA GGATGCTGCCTCCAACGATTACATCAACCAGCTATGTGGTGGTGACTGTT GGATCGGACTGAATGAACAGAGTGTTGAAGACCGTTGGCAATGGGAGGAC GGGTCGATTCTGAGCGCTGCAGGCTTCAGCAACTGGGCCAGAAGAGCGAG AAACCACCACGCAGGAGGAAGGTCCGGTTCGGGTTCAAACTCAGGATCAG GTTCAGGCAACAAAGATGACAATAAAGACTGCGCCCTGCTGAAGCAGAGT GGACCGAAGTGGGAGGAGCACGACTGTGGTCATGGTCACCATTTCGTCTG CCAGTCAAATCACGGTATGGCGTTTTCATCGAATTGCATGGTAACGGCTA ATAACGTTAATATGCATAAATAGTGACCAATCTCTTCAAAATTTCCCTAT CAATCATGCAAAATAAGTTATAGTTTGCATCTAATCATGTGAATCTCTTA GTAACCTTAGCTGATTGTATTATATATGCCAACATTATGAGAATCCGTTT GCCCTTTCTTTAGCTATTTTCTTCCAAAGTTTCAAACATAAACGCCCATG CAGTTGCAAAAGACGCTGTAAGCTTGCTGGGGGCGATGCACACCCAAGCT CAAAACAAAATGCTTACCTCCTTTTTGCAAGACGATTCAGTAGTATATCA ATCTATGCAAGATGGAGTTTTATTGTCCAAAAGATAAGAGAGGATCTACA CTGTATGTCGAAAATCAGTGGTAGAGGCTAATATTTATTGACTACAGTAA TTGACGAAATACGTGACGGTGACTGTTTCAAAGTTTTATCCAGTTGCTTG AGAAATATCATTTGGCGTGAGTAACTGTTGTGTGGTTTCTTGTTTTCAGT AATTCACTCCCAGGTTCAGACCCAGTGCACCGTACTGGCAAACCCGGATC CCATTTCCCAGGGCAGCGTGACGGGGCCGAC

Coding sequence (CDS) from alignment at Sc0000091:636250..638730-

>transcript:BL97354_cuf9 ID=transcript:BL97354_cuf9|Name=transcript:BL97354_cuf9|organism=Branchiostoma lanceolatum|type=CDS|length=5616bp|location=Sequence derived from alignment at Sc0000091:636250..638730- (Branchiostoma lanceolatum)
CCTCCAGCTCATGGGACCATCAGTAGTGTAACAGCTCCCTCTGCCGGTAC
CTGGAACTCACTGCAGTGCGATACCGCCGTGGTAAACCAAGGCCCGGTCC
ATACCGTGAACTGTGGTACTGACTCCACCAACTTCAACGGCCAAACCTTC
ACCGTCAGTTGTCCTGTTGGGTGCTCTGGGTGCACTGGTTGTGTCTGGGG
GTCTGGTGTCTACACGGTCGATTCGAGTATTTGCTTTGCTGCTATCCATG
ACGGAAGGATCACGAATGCTGGCGGACAGGTGACTGTGCACAGATGGCCC
GGACAGAGCTCGTACCACGGATCCTGGCAAAACGGCATCCAATCGAGGGA
TTATGGACACTGGGGCAGTTCCTTCGCCTTTACACCAGGTAACAGAGAAC
AAAAGTCGTCAACTACTACCTGCGCTTCATCAGGCTACACCAGTTTCAAC
GGGATCTGCTACAAGGCCTACAGCCGAAACAAGAGCTACAACCAGGCCAG
ACAAGTTTGTGCCGCAGACGGCGGGTTCTTAGCCATGCCGAAGGATGCTG
CCTCCAACGATTACATCAACCAGCTATGTGGTGGTGACTGTTGGATCGGA
CTGAATGAACAGAGTGTTGAAGACCGTTGGCAATGGGAGGACGGGTCGAT
TCTGAGCGCTGCAGGCTTCAGCAACTGGGCCAGAAGAGCGAGAAACCACC
ACGCAGGAGGAAGGTCCGGTTCGGGTTCAAACTCAGGATCAGGTTCAGGC
AACAAAGATGACAATAAAGACTGCGCCCTGCTGAAGCAGAGTGGACCGAA
GTGGGAGGAGCACGACTGTGGTCATGGTCACCATTTCGTCTGCCAGTCAA
ATCACGTAATTCACTCCCAGGTTCAGACCCAGTGCACCGTACTGGCAAAC
CCGGATCCCATTTCCCAGGGCAGCGTGACGGGGCCGCCTCCAGCTCATGG
GACCATCAGTAGTGTAACAGCTCCCTCTGCCGGTACCTGGAACTCACTGC
AGTGCGATACCGCCGTGGTAAACCAAGGCCCGGTCCATACCGTGAACTGT
GGTACTGACTCCACCAACTTCAACGGCCAAACCTTCACCGTCAGTTGTCC
TGTTGGGTGCTCTGGGTGCACTGGTTGTGTCTGGGGGTCTGGTGTCTACA
CGGTCGATTCGAGTATTTGCTTTGCTGCTATCCATGACGGAAGGATCACG
AATGCTGGCGGACAGGTGACTGTGCACAGATGGCCCGGACAGAGCTCGTA
CCACGGATCCTGGCAAAACGGCATCCAATCGAGGGATTATGGACACTGGG
GCAGTTCCTTCGCCTTTACACCAGGTAACAGAGAACAAAAGTCGTCAACT
ACTACCTGCGCTTCATCAGGCTACACCAGTTTCAACGGGATCTGCTACAA
GGCCTACAGCCGAAACAAGAGCTACAACCAGGCCAGACAAGTTTGTGCCG
CAGACGGCGGGTTCTTAGCCATGCCGAAGGATGCTGCCTCCAACGATTAC
ATCAACCAGCTATGTGGTGGTGACTGTTGGATCGGACTGAATGAACAGAG
TGTTGAAGACCGTTGGCAATGGGAGGACGGGTCGATTCTGAGCGCTGCAG
GCTTCAGCAACTGGGCCAGAAGAGCGAGAAACCACCACGCAGGAGGAAGG
TCCGGTTCGGGTTCAAACTCAGGATCAGGTTCAGGCAACAAAGATGACAA
TAAAGACTGCGCCCTGCTGAAGCAGAGTGGACCGAAGTGGGAGGAGCACG
ACTGTGGTCATGGTCACCATTTCGTCTGCCAGTCAAATCACGTAATTCAC
TCCCAGGTTCAGACCCAGTGCACCGTACTGGCAAACCCGGATCCCATTTC
CCAGGGCAGCGTGACGGGGCCGCCTCCAGCTCATGGGACCATCAGTAGTG
TAACAGCTCCCTCTGCCGGTACCTGGAACTCACTGCAGTGCGATACCGCC
GTGGTAAACCAAGGCCCGGTCCATACCGTGAACTGTGGTACTGACTCCAC
CAACTTCAACGGCCAAACCTTCACCGTCAGTTGTCCTGTTGGGTGCTCTG
GGTGCACTGGTTGTGTCTGGGGGTCTGGTGTCTACACGGTCGATTCGAGT
ATTTGCTTTGCTGCTATCCATGACGGAAGGATCACGAATGCTGGCGGACA
GGTGACTGTGCACAGATGGCCCGGACAGAGCTCGTACCACGGATCCTGGC
AAAACGGCATCCAATCGAGGGATTATGGACACTGGGGCAGTTCCTTCGCC
TTTACACCAGGTAACAGAGAACAAAAGTCGTCAACTACTACCTGCGCTTC
ATCAGGCTACACCAGTTTCAACGGGATCTGCTACAAGGCCTACAGCCGAA
ACAAGAGCTACAACCAGGCCAGACAAGTTTGTGCCGCAGACGGCGGGTTC
TTAGCCATGCCGAAGGATGCTGCCTCCAACGATTACATCAACCAGCTATG
TGGTGGTGACTGTTGGATCGGACTGAATGAACAGAGTGTTGAAGACCGTT
GGCAATGGGAGGACGGGTCGATTCTGAGCGCTGCAGGCTTCAGCAACTGG
GCCAGAAGAGCGAGAAACCACCACGCAGGAGGAAGGTCCGGTTCGGGTTC
AAACTCAGGATCAGGTTCAGGCAACAAAGATGACAATAAAGACTGCGCCC
TGCTGAAGCAGAGTGGACCGAAGTGGGAGGAGCACGACTGTGGTCATGGT
CACCATTTCGTCTGCCAGTCAAATCACGTAATTCACTCCCAGGTTCAGAC
CCAGTGCACCGTACTGGCAAACCCGGATCCCATTTCCCAGGGCAGCGTGA
CGGGGCCGCCTCCAGCTCATGGGACCATCAGTAGTGTAACAGCTCCCTCT
GCCGGTACCTGGAACTCACTGCAGTGCGATACCGCCGTGGTAAACCAAGG
CCCGGTCCATACCGTGAACTGTGGTACTGACTCCACCAACTTCAACGGCC
AAACCTTCACCGTCAGTTGTCCTGTTGGGTGCTCTGGGTGCACTGGTTGT
GTCTGGGGGTCTGGTGTCTACACGGTCGATTCGAGTATTTGCTTTGCTGC
TATCCATGACGGAAGGATCACGAATGCTGGCGGACAGGTGACTGTGCACA
GATGGCCCGGACAGAGCTCGTACCACGGATCCTGGCAAAACGGCATCCAA
TCGAGGGATTATGGACACTGGGGCAGTTCCTTCGCCTTTACACCAGGTAA
CAGAGAACAAAAGTCGTCAACTACTACCTGCGCTTCATCAGGCTACACCA
GTTTCAACGGGATCTGCTACAAGGCCTACAGCCGAAACAAGAGCTACAAC
CAGGCCAGACAAGTTTGTGCCGCAGACGGCGGGTTCTTAGCCATGCCGAA
GGATGCTGCCTCCAACGATTACATCAACCAGCTATGTGGTGGTGACTGTT
GGATCGGACTGAATGAACAGAGTGTTGAAGACCGTTGGCAATGGGAGGAC
GGGTCGATTCTGAGCGCTGCAGGCTTCAGCAACTGGGCCAGAAGAGCGAG
AAACCACCACGCAGGAGGAAGGTCCGGTTCGGGTTCAAACTCAGGATCAG
GTTCAGGCAACAAAGATGACAATAAAGACTGCGCCCTGCTGAAGCAGAGT
GGACCGAAGTGGGAGGAGCACGACTGTGGTCATGGTCACCATTTCGTCTG
CCAGTCAAATCACGTAATTCACTCCCAGGTTCAGACCCAGTGCACCGTAC
TGGCAAACCCGGATCCCATTTCCCAGGGCAGCGTGACGGGGCCGCCTCCA
GCTCATGGGACCATCAGTAGTGTAACAGCTCCCTCTGCCGGTACCTGGAA
CTCACTGCAGTGCGATACCGCCGTGGTAAACCAAGGCCCGGTCCATACCG
TGAACTGTGGTACTGACTCCACCAACTTCAACGGCCAAACCTTCACCGTC
AGTTGTCCTGTTGGGTGCTCTGGGTGCACTGGTTGTGTCTGGGGGTCTGG
TGTCTACACGGTCGATTCGAGTATTTGCTTTGCTGCTATCCATGACGGAA
GGATCACGAATGCTGGCGGACAGGTGACTGTGCACAGATGGCCCGGACAG
AGCTCGTACCACGGATCCTGGCAAAACGGCATCCAATCGAGGGATTATGG
ACACTGGGGCAGTTCCTTCGCCTTTACACCAGGTAACAGAGAACAAAAGT
CGTCAACTACTACCTGCGCTTCATCAGGCTACACCAGTTTCAACGGGATC
TGCTACAAGGCCTACAGCCGAAACAAGAGCTACAACCAGGCCAGACAAGT
TTGTGCCGCAGACGGCGGGTTCTTAGCCATGCCGAAGGATGCTGCCTCCA
ACGATTACATCAACCAGCTATGTGGTGGTGACTGTTGGATCGGACTGAAT
GAACAGAGTGTTGAAGACCGTTGGCAATGGGAGGACGGGTCGATTCTGAG
CGCTGCAGGCTTCAGCAACTGGGCCAGAAGAGCGAGAAACCACCACGCAG
GAGGAAGGTCCGGTTCGGGTTCAAACTCAGGATCAGGTTCAGGCAACAAA
GATGACAATAAAGACTGCGCCCTGCTGAAGCAGAGTGGACCGAAGTGGGA
GGAGCACGACTGTGGTCATGGTCACCATTTCGTCTGCCAGTCAAATCACG
TAATTCACTCCCAGGTTCAGACCCAGTGCACCGTACTGGCAAACCCGGAT
CCCATTTCCCAGGGCAGCGTGACGGGGCCGCCTCCAGCTCATGGGACCAT
CAGTAGTGTAACAGCTCCCTCTGCCGGTACCTGGAACTCACTGCAGTGCG
ATACCGCCGTGGTAAACCAAGGCCCGGTCCATACCGTGAACTGTGGTACT
GACTCCACCAACTTCAACGGCCAAACCTTCACCGTCAGTTGTCCTGTTGG
GTGCTCTGGGTGCACTGGTTGTGTCTGGGGGTCTGGTGTCTACACGGTCG
ATTCGAGTATTTGCTTTGCTGCTATCCATGACGGAAGGATCACGAATGCT
GGCGGACAGGTGACTGTGCACAGATGGCCCGGACAGAGCTCGTACCACGG
ATCCTGGCAAAACGGCATCCAATCGAGGGATTATGGACACTGGGGCAGTT
CCTTCGCCTTTACACCAGGTAACAGAGAACAAAAGTCGTCAACTACTACC
TGCGCTTCATCAGGCTACACCAGTTTCAACGGGATCTGCTACAAGGCCTA
CAGCCGAAACAAGAGCTACAACCAGGCCAGACAAGTTTGTGCCGCAGACG
GCGGGTTCTTAGCCATGCCGAAGGATGCTGCCTCCAACGATTACATCAAC
CAGCTATGTGGTGGTGACTGTTGGATCGGACTGAATGAACAGAGTGTTGA
AGACCGTTGGCAATGGGAGGACGGGTCGATTCTGAGCGCTGCAGGCTTCA
GCAACTGGGCCAGAAGAGCGAGAAACCACCACGCAGGAGGAAGGTCCGGT
TCGGGTTCAAACTCAGGATCAGGTTCAGGCAACAAAGATGACAATAAAGA
CTGCGCCCTGCTGAAGCAGAGTGGACCGAAGTGGGAGGAGCACGACTGTG
GTCATGGTCACCATTTCGTCTGCCAGTCAAATCACGTAATTCACTCCCAG
GTTCAGACCCAGTGCACCGTACTGGCAAACCCGGATCCCATTTCCCAGGG
CAGCGTGACGGGGCCG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97354gene:BL97354Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97354_cuf9transcript:BL97354_cuf9-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97354_cuf9-E1BL97354_cuf9-E1-1564476830-291002Branchiostoma lanceolatumexon
BL97354_cuf9-E2BL97354_cuf9-E2-1564476830-291000Branchiostoma lanceolatumexon
BL97354_cuf9-E3BL97354_cuf9-E3-1564476830-290998Branchiostoma lanceolatumexon
BL97354_cuf9-E4BL97354_cuf9-E4-1564476830-290996Branchiostoma lanceolatumexon
BL97354_cuf9-E5BL97354_cuf9-E5-1564476830-290994Branchiostoma lanceolatumexon
BL97354_cuf9-E6BL97354_cuf9-E6-1564476830-290992Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000091genomeSc0000091:636250..638730 -
Properties
Property NameValue
Transcript idBL97354_cuf9
Biotypeprotein_coding