Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97247_cuf6 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97247_cuf6
Unique Nametranscript:BL97247_cuf6
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97247_cuf6

>transcript:BL97247_cuf6-protein ID=transcript:BL97247_cuf6-protein|Name=transcript:BL97247_cuf6|organism=Branchiostoma lanceolatum|type=polypeptide|length=143bp
GGSSGDKARLLSPSLSATPASCVQFWYYMSGAGVASLNVYTRQQQQQKVL
VANITGDQGDQWRMKEVEIVSNSDYVIVFEGIKGTRLNGDIAIDDISVTG
GACTSPAFNNCRNNPCLNNGVCVDGLGQYTCTCMSGWYGNRCE
Run BLAST on NCBI

mRNA from alignment at Sc0000002:8263149..8264405+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97247_cuf6 ID=transcript:BL97247_cuf6|Name=transcript:BL97247_cuf6|organism=Branchiostoma lanceolatum|type=mRNA|length=1257bp|location=Sequence derived from alignment at Sc0000002:8263149..8264405+ (Branchiostoma lanceolatum)
GGGGGATCATCAGGAGACAAAGCACGTTTGCTCTCTCCTAGCCTGTCCGC CACCCCCGCGTCGTGTGTGCAGTTCTGGTACTACATGAGCGGTGCAGGCG TGGCGAGCTTAAACGTCTACACGCGACAGCAGCAGCAGCAGAAAGTGCTG GTGGCAAACATCACGGGAGACCAAGGAGATCAGTGGAGGATGAAGGAAGT GGAGATTGTGTCGAACAGTGACTATGTGGTAAGTGCTGTCATTCCACGGC TAATTGTGTGTTCGTTATTCTATTCTGTTGTCGTGGAGGACATAATCGGA TGCCAACTCGGTAACCTTGGAACCTGGGATTTGAATTTTCACCTGAAATT TGTATTTTCAGAGGTGATGTTTGATATTAGCTATTTGCTAGAGTGCATCG CCTCTGTATCCTGTATATTCGTTCCTTGATTAATAAAAAGATAACAAAAA AGACCATGGATCGCCTTACGCCACGTTTCCCTATACTCGATTAGCATTTG TAACACGGCTGTACTCCCGAGTCCCGTGTCTCTACTCAGGTTGTCAACGA TAGTTGTTCATCCTTTGACTGGGTTCCGTTTTCCTTATGTTGGCTCCCAC AGGTTGAGATATTCTATTCGGTAGTGTATCATTATTTACGAAGCGTATGC CGTGCATGTGTAGTGTTAAATATATACACAACTGACATTAACTTCTCAAC ATGTTTCCTGCAGATCGTGTTTGAGGGAATCAAAGGCACTAGGTTGAACG GAGACATCGCCATTGACGACATCAGCGTCACAGGCGGAGCATGTACATCG CCTGGTAAGTACAAATGAAACATCAATGCTGTCTGGCAGCGCACTGTTGA TTTCATATATTCTGTAACGTAACACAGCAGATACAGGATCGACTGAGCTC TTTCAACGATTCTCAGTAAATAACCCAGAGATAAACATATAGAAAGCTAA ACAAAATATTTCCTTCACGAAGATAACTACAGATTTTCCATAAAATACCT TTGGAGAATAAACTTAATAATTGAGATAGTCTTATCAGTTTCTAGAACTG AGGTCGTGCCATTACATGATTTCATTACCAAAGACCTTTATTTGTTCTGT ATTCTCCCTGATATAAATCGTTTCTGCTTTGTTCCTTTCTTGTACAGCGT TCAATAACTGCAGAAATAATCCATGTCTCAACAATGGCGTTTGCGTGGAC GGACTTGGTCAGTACACCTGTACATGTATGTCGGGGTGGTATGGAAACAG ATGTGAA

Coding sequence (CDS) from alignment at Sc0000002:8263149..8264405+

>transcript:BL97247_cuf6 ID=transcript:BL97247_cuf6|Name=transcript:BL97247_cuf6|organism=Branchiostoma lanceolatum|type=CDS|length=1287bp|location=Sequence derived from alignment at Sc0000002:8263149..8264405+ (Branchiostoma lanceolatum)
GGGGGATCATCAGGAGACAAAGCACGTTTGCTCTCTCCTAGCCTGTCCGC
CACCCCCGCGTCGTGTGTGCAGTTCTGGTACTACATGAGCGGTGCAGGCG
TGGCGAGCTTAAACGTCTACACGCGACAGCAGCAGCAGCAGAAAGTGCTG
GTGGCAAACATCACGGGAGACCAAGGAGATCAGTGGAGGATGAAGGAAGT
GGAGATTGTGTCGAACAGTGACTATGTGATCGTGTTTGAGGGAATCAAAG
GCACTAGGTTGAACGGAGACATCGCCATTGACGACATCAGCGTCACAGGC
GGAGCATGTACATCGCCTGCGTTCAATAACTGCAGAAATAATCCATGTCT
CAACAATGGCGTTTGCGTGGACGGACTTGGTCAGTACACCTGTACATGTA
TGTCGGGGTGGTATGGAAACAGATGTGAAGGGGGATCATCAGGAGACAAA
GCACGTTTGCTCTCTCCTAGCCTGTCCGCCACCCCCGCGTCGTGTGTGCA
GTTCTGGTACTACATGAGCGGTGCAGGCGTGGCGAGCTTAAACGTCTACA
CGCGACAGCAGCAGCAGCAGAAAGTGCTGGTGGCAAACATCACGGGAGAC
CAAGGAGATCAGTGGAGGATGAAGGAAGTGGAGATTGTGTCGAACAGTGA
CTATGTGATCGTGTTTGAGGGAATCAAAGGCACTAGGTTGAACGGAGACA
TCGCCATTGACGACATCAGCGTCACAGGCGGAGCATGTACATCGCCTGCG
TTCAATAACTGCAGAAATAATCCATGTCTCAACAATGGCGTTTGCGTGGA
CGGACTTGGTCAGTACACCTGTACATGTATGTCGGGGTGGTATGGAAACA
GATGTGAAGGGGGATCATCAGGAGACAAAGCACGTTTGCTCTCTCCTAGC
CTGTCCGCCACCCCCGCGTCGTGTGTGCAGTTCTGGTACTACATGAGCGG
TGCAGGCGTGGCGAGCTTAAACGTCTACACGCGACAGCAGCAGCAGCAGA
AAGTGCTGGTGGCAAACATCACGGGAGACCAAGGAGATCAGTGGAGGATG
AAGGAAGTGGAGATTGTGTCGAACAGTGACTATGTGATCGTGTTTGAGGG
AATCAAAGGCACTAGGTTGAACGGAGACATCGCCATTGACGACATCAGCG
TCACAGGCGGAGCATGTACATCGCCTGCGTTCAATAACTGCAGAAATAAT
CCATGTCTCAACAATGGCGTTTGCGTGGACGGACTTGGTCAGTACACCTG
TACATGTATGTCGGGGTGGTATGGAAACAGATGTGAA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97247gene:BL97247Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97247_cuf6-E1BL97247_cuf6-E1-1564476830-39570Branchiostoma lanceolatumexon
BL97247_cuf6-E2BL97247_cuf6-E2-1564476830-39572Branchiostoma lanceolatumexon
BL97247_cuf6-E3BL97247_cuf6-E3-1564476830-39574Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97247_cuf6transcript:BL97247_cuf6-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000002genomeSc0000002:8263149..8264405 +
Properties
Property NameValue
Transcript idBL97247_cuf6
Biotypeprotein_coding