Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97207_cuf6 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97207_cuf6
Unique Nametranscript:BL97207_cuf6
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97207_cuf6

>transcript:BL97207_cuf6-protein ID=transcript:BL97207_cuf6-protein|Name=transcript:BL97207_cuf6|organism=Branchiostoma lanceolatum|type=polypeptide|length=1780bp
AVQLVDLSESVMGGSAVFRLYTTYYTDFTALSARLAGGGVMGGRTVGSSM
AMSKALSTSGREFLVAFTGNDPADMTNPRLYISSSGGRNTSVTVSADLGG
FQTTVTVSGSQVVMVEVPNDLVMVGSTTHSERVISVTSTEAPVTVYGLVK
ELYTIQPFIALPKSSLGTEYVAVMYTPTNGYPSQFTIAATEDDTTVTIRS
MATIEYAGLAPVTPAEDLTLTIGPSTIGAVQIVDQEDLSGTYITSNKPIA
VFSGNQFAEFPGSPPGGHIQQQLKPVSSWGKTFIIHAASANIFRVTAAFE
FTTVTLSNGMTQNIDVLSMWEFDFSETTSFDQYFIMTSTQPIQVVVFQKG
RSVNNIQMGPTMLTLSPTEQWASTYSLTTLELPGVSSTPNLVLFVRSADI
SGLRFEGGRLPLGTAWRNIPNSDLSWVMMQISSGTSRIWHISPLARFGAF
VYSLAADGSTYVVPAGYHLSPLAVCDRGNGTAGDGRDNDCDGLFDEELPN
GIDDDMDGTIDEADMALNPCDRNPCSNGVCEVTRGGYQCRCDEGFSGFSC
DISLGGLDGPTWLLSDPGWIAEEDMAWEAAANLTLDGDNTTCWDPGSGTR
YLTFNLGSSYTIFQVRFTGKMPSDFVPKSVMLQVHGGPGGNWTDIKRVAV
PEMLNGPISFGGFSATGRLWRLQVSDTHSGLYNPQVCELQFFGQEVVTTS
YTLLPLQGTYTENLVNTQGKTALAVNVETNVLKYYSMRPDFRGLYGLQVT
DIKPLGAYVTAEVSFISSASQVMYQEMALQDAVAMGTVNNVAVINDTGIM
LTPRVPPCTVPTDLVFAIDGTVSPSTFSAIVAFIKRVVHTFTIGPEATQV
SVAQGGSSPRLDFPLNQFQSLPGLIQGLDAIQQTDMPGEGRRFSHLGVFM
QGNGGRTGVNRLAVFVTDGVTDAADFQRASENGVVTFTVAIGDDADLASL
EAFSPSSNFVFRVSDSYGLVDLGNRLPRKLCEVGVTSYMAVTLNVNYTTE
FLTAASPGFTALNLAVKTTFLTGLQDMFGFQAAQVVNLMPGPVYSTRANI
RVIAGAYALDDIQQKVFNITAAGQFGSYSFDTATITYDQIANQFLYGYIE
VRTVFMQSYRDQFSASYRMLASSVKLNVLRIFIRLYGVRSMAVTNIKPGT
TATTTWVDFQMNCAQTAVPSIVTSYLNVTDSYQMVGTLDILPGSGYLSIE
APRCGVEVDLVLVLDDSGSVGAENFNKLKGFVKRLTTQFEFGQDATRLGI
LQYSTDVKTVFSLNSYDTLEDINTAIDGMMYKGGGTNTHLALYELVNNAF
SFQNGARPTASKVAVIITDGKSSQPITRAVQEVKTAGIIVYAMGVGSGTD
QSELQEIASSSDRVFSALNYDSLLSLTGGLANRFCDDGSSVVSVATVDLD
EDFNIDLLNVTSSTFISLRATLLYQLNFELGRFANLILVNVNFQLSMNDK
VRVVFTMNSLGYIVNDLQVIINQVASSGNFGNLTVTGAIFDAQGPTVLYG
IMEVNRTFTSELRGISSYEAAALSITFKYQLLQSLTTSVNFARVTDISPG
YAATTTLVSFVTSVSANVSDAVLTNFNTSVAATPMFLQGSLSPEFPLCPA
KMEVVFVLDGSGSVGYDNFQRMKSFVKRVAGSFAIGPSATQISLFQYSSF
VMQEFALDTYGSIGEINQAVDVVMYQGGGTATGLALYEMRQYGFSFGNGG
RPGTRRVAILLTDGMSSDSVDKHAMAAWQAGISLYVVGIGSNVDMDELLA
IGGTPDNIFGLSNFGQLQDLGNRLPNRLCE
Run BLAST on NCBI

mRNA from alignment at Sc0000054:19547..48586-

Legend: five_prime_UTRexonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97207_cuf6 ID=transcript:BL97207_cuf6|Name=transcript:BL97207_cuf6|organism=Branchiostoma lanceolatum|type=mRNA|length=29040bp|location=Sequence derived from alignment at Sc0000054:19547..48586- (Branchiostoma lanceolatum)
GGGCTGTCCAGCTTGTGGACCTCAGTGAAAGGTAAGTCGTACATTGCCTA GTGATGTGGATCTTTCGGTGTTTAGCTGTGTTAGTGATCAATTAATTTTC TTACTTTGATAATCTACAATGTCATACTTATGATAAATCTACCTGCCATA GTTGCAAGAAATGATTCATGATATACTGAACAACTGATTAATTACATGAG GTGGAAATGAAAAGAATGAATCATGATGTGCAAAGTTAAAGATTGTTGTA GATCAAACAGGTGGTTGTGTTTTTGTCACAACTCCAATTTGGTACAACTG TAATTTAACGGTTGCAATGCATGCTGTATTGCTGCAGTGTGATGGGTGGG AGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCT GAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCA GCAGCATGGCAATGTCCAAAGGTGAGTCAAAACACAAGTTGTACCGAAAA AACTCTTAAGATACTTTTTTTGTACAAATTCACTCCAAATGTTTGTCAGG TTTTCAATTTTTCTAAAACTTTGATGTGATAATGGATAGGATATGATTTC ATCATCGTCATTCCAGGATGGTGTCGCTCCTATGGAGAAACAACTCCCTT GACTGACTCCAGTCTTTTCTGAGTCTCACAGTTCTTGGCCATGATATGAT CTAGGCAATGCTTAAGTATGATATTTGAATACCTTTCCCTTTGTAATCTA AGGTCTATTTCTTGGTTCCACAGCATTGAGTACATCTGGCCGGGAGTTTC TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA CCTTGGAGGCTTCCAGGTATTTTTTATACAACAATGTATGCTTTTATGAA AGAGTGCAGCAGCTGTAGAAATCTACCCACATTATTGTTAAATTTTGTAT TATTTGATCTTGGACTTATCAAATGTGCTGAAATTGAATGTAAGTAGCTG TTGCTGTCAGACATTGTAAAGAGCTGCTGTAAAAAAAAAAAACTAAAATT CTGTGTTATGAATTCTTTATCACACTTTCTTTACTTAAACTTGATGTTGT ACATACCCAAAAGGAACAATATTATTTAGCCCAATTTTCTCCCCTTTTTA GACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAA ATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCT GTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCT CTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAG AGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTC ACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGC AACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTA CTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAA GAGGATCTAAGTGGTATGTTCAGAATTTTAACAAAATATAAGTTATTCTA GAACTCAGTCATAGACTAAAGTTGATAACCTTGTTTGTTTTTAGTATTTT ACATCTACATGCAGTTTCATTGCCACCATATTAATCTATATGACTAAAGA ACTTCAAGTTGTTATTAGTGCATCACATATATATGTATAATTATATAAAA AGTTGATGAAGTATTCCAAAAGGATATCATGGGAGATACCTGCTGATAAA AGACTTTGAAAGCAGTTTTTTCCATGATACCCTGTTGGAATACACATTAA GTTTTTATTTTAGCTACTAACGTTATATGGGATGCACTAACAGATGCTTT TTTATTCTATTTTAGTTCACTTCATTTTATTACTGCCTTATGTCATACAA ACTGCCATTCACACTAACAAAGAGAATGTCTCCATTGACAGGAACCTACA TCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAG TTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGT CAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCT TCAGGTATGGCATGGAGACACCTGTGTGTGTGTGTGTGTGTGTGTGTGTG TGTGTGTGTGTGTGTGTGTGTGTGTATGCAGAAAGAAGGGTGGGAGGAGG AAAGATTCTTGGCATTCTATTTTTGTGAACTCTGGCAATGAGAATGCAAT GTTTCCATCACTGTCTTGATTCAGTCACATTGTCGATTTCTTCACCATTG TTTTCTTTGTTTCTGTTGCTAGGGTGACAGCAGCCTTTGAATTCACAACA GTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTG GGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGA CATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTG AACAACATTCAGATGGGCCCAACCATGCTGGTAATCCATTCACAGTGATA GCTGTTGTACCCTAATTTGCTTCCTATGAGTATATTTAGATACCTATGAA ATATTTGAAATACTGATAATTGAAATTCTCATAAAATAATAAGATCATAG TAATTTTGTTTTTTGGTATCTTTAATTCCTGTTTGGCTTGGAGCAGTCAT TTTCTTTGTGAAAATAATCGTAATAGTAGCTGATAGATGTCAATGGACTG GGACATGTGCTTGATTTTTTGTATTAATGATAATACTATAACAGTAACTG TTATTCTCGAATGATGATATTATATTTGGGAGTGTACCTACTTGTACTTG TTGAGGTCTTCTCATCAATCATTTGAGTGACCTGTGCCAAAATGAATGTT TCTCCATCTTTGGAAGTGACTCACTGAAAATGTATAATTTTGTTATTGTA TCCCAACTCAACATTAAAAGTTTTTGTTTATTTGTTTGTAGACCTTGTCC CCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCC AGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACA TCAGCGGTCTTCGTTTTGAAGGTGAAACTTCAGAATTTCCTTAACCCGCC ATGGAGAGAGAATGTTCACTTGTACTTAATGTACTTATTGTAATTGTTCA CTTTTGAAAATACATGTGACCTGAAAGTCAGTGTAATGTATTGTTGCATT TGACAATAGATGAATTGATACTCTCACTGTATTCATTCAACGTTGTATTC TGCTACATGCATTTCACTTTCCACAAATCGGAGCACCAACACATTTTTGT TGTTGTTGTTAGTAGAGTCCTAACACATTCAAAAGGAGGATCTTAGAAAT CAAAATTGATATACAAAACATATATTTCCAAATGGATATTGTGTTTTGCA TGCTAAAGGCAGACCCCAAACACAGTGGACTAGGTCCCACAACAACAGAA AGAAATTCTAGGTCCCACTACAAAGATACGAGAGCTTAAAGATTGCAAGA TGCAGTGGAAGTCTCCACAACTGCAGATGCAGAAACCAGTATATGATGAT GATTCATTGGTTGGCAAAGTTGCTCCCTGTGGTCTTACACGATGCCTGTT AATTTTGTACCAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACAT TCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTT CCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTAC AGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGGTACAGTATTGTG AAGACTGTAGATTGCTTGTGATCTTAATAGTGTCTGTAATGCTGTTGCTT AAGCCACTCCTATTTCCTTTGTTCCCATGCATCTTAAATCAGAAACCAGG CAAAAGATTAACATGAAAACAGTCAGAGGTCTAAGCTTTCAAGTTTTCAA AAAGATTTGTATTTATCTTCTTCTTCCTTTTTCAGCATTGTTTCTTTCAA GAAAATAAATCGGTTTCTAGTTCTTATGTAACAAACATAAAGAATGTTTG TCATGCTGTCCTTGATGAGTGCAATTGTCTTGGATTCAAAGTCAGCTTTT ATGTTCATCACTATGATCTAATTACAAAATGTGGAATAGATTTTCTCAAC AACTGTAAATTGTATGATCCAAAGTGGTATATATACACTATGTATGAGTT CATTACAACTTCTTTCCATTCCATCTTTGTTGCAGCTGGATACCACCTGT CCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGG GACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGA TGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGG TAAAAGTCTTGAATCCTACTCCTCTATTTACTTCATTTAGTTCCATTAGG TTTTTAGTGTGTAATTTGAACTGAGCTATGCTAACAGAATGAAATAGATT TATCATCCATTGGTTGCTTTCAGCTGAAAGCAAAGATAAATGGTTAAAAA ACATAGAAGTGTAACAAATCAAGTAAGTGGTATCTGATAAAAATCTCTAT GGTGCTATCAGTCTTCTCTCTGTTTCTTTATTCAAGTGTAAGAGCTAACA ATAAACATAGTTTTACCTTTTTCTGAAAAAATTCTTACCTGTCGATGGAA GTTGTACATGTACAGAGTGCAGACTTTTGCTAGTTTGGACAACATAACAA AGTTCTGTTCTCAAGTGTGTTAAATTCTTTTCTCTCCCTTAATTTCTGTA GTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAG GGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATT AGTAAGTCTTTTGAAATCCTTGATGGCTGCTGTATAAAGTATACAGCAAT ACAGTTATACTTAAAAGAAGATGTCATTGGTAAATTTTGGAAATTTTGTC ATATGCCATCAACAAAGTCCGGTGGTGAAAGAGTCATTTTCAGAAGTTTG TTTGTATCTTTTGGTGAACGATGTCTAGTCTGGTACCAAGGACAGTTCCT TCATAGGCTTTTAAGTGGAAATTTTAATGGCTGATAATGTGTATGGATGG TGTGTAGTATAAAAGATACATTAGAATGCTTTGTTTGGATTATGTGCCAT CAGTCTAAGTGTTTTTATTGTTTACTGATAGTGTCAACAGACAAAATGGC ACTTGTGTTACAACAAATGGCATTCAGCACCAAGGACAGATGCTATTGTA TGGATTTTGAAGCAAGAATGTATTATAACATGTTTTAGATGCTTGATATC AATCAAATAAAGCCGATTACTTTTAACATTACCAAAAAGAAACACAGCTA TTGTATGAAATGGCAGAAAATGGAATGTCTACCTCAGTGTGAAAAGTGCT ATGAAAAGTCAATGAGCAAGTATAATTACAGCAATGATTTTTCTTTAAGA ATGTCACTCCCTCTGTACACTAAAACAAACACTACGGTACCATTCTCAGG CCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGA TTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGAT GGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGAC TTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTATCTAGAAATTTTG TTCATTGACAATCTTGTCACAGGAATTGTTGTTTGTACAGGAAAATCTGT CTGTTTTTATATACAGAGCCACTAGCAATCTTTTCATATCGAGTAGACTG CTGACACATCTTGAACAGCACAATATGAACTATGCTCATATTTAATGTAC ATGTATCAAAAGACAATGTGCCAACAGAACTTAAATCAATTCATGACTGT AATAAATTATTTTCTCTCTTTGTCTCAGGTCCGTTTCACTGGTAAGATGC CATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCA GGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAA TGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGC TGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAA CTGCAGTTTTTTGGACAAGAAGGTTTGTATCACCCACTCCCTCAATCACT CACTATCTGGTTTATTGTTGGTTGTTCCCCATCTCACAATAGATGTGATT GCACATAGACAGCAAACAATCTTAAAGTTAGGTGATTTAGACACATGCCA AAGGAGAGAAATTTGTCTTCAAATGATTTTTCAAGGAAAGTGGCATATGG CTTTGACTTTGAGTTGTTAGTGTACAGTTGCATTACCTGTACAGTACTGT AAGTCCCTTGAATGTAGTCTCTACTTATGTGTCATCATCCACTGAGCTAA ATGTAATCCACTGACTCAGGCTTTTGGTTATCAAAATATCGTTTGAAACT TTGACTTTTGATTGTGACCTGCACTGATTATTTTAATGATTCTGAACTGT TTCAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACA CAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTG GAGACTAATGTAAGCTACTTATTTGTACATCTTGTTTATTTATTTATTGT CAAATGCAACAGTACATTACACCGACTCTCAAGGCAGCGTAGCTGATATT GCAGAGTCTGCATTTATGGACAGACAGACAGATACATAAATGTAGGCAAT GGAAAATTTACACAACACAATCTTTTACATCTTGTTACCTTCAGCTAAAA CATTGCTAGCCTACATTGGTCACTTCTAAATCTAAAAGCTTGTCATATTT CTGGCTCACTTTGACCACACTTGTCACAGCTATCTGGTATTTGAGAGTAT TTTTTATCTTTTTGTCAGATTTCTATAGTTATCACTAAATGTATGATTGT CTTTCACCTATTAGGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGG GGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGTAAGTACTTGT GGACATTTGGACTTGATTTTGGAAAATGTTTTGCTAGGTTCTAACAATTG TCGGGTGACTTGATGACATATATTGTGTGTGTTGTGCCCTCTATTTGTGC TTTGCATCACTAGTTTTCATATAACTAGAGATACATGAAGGAGTACTCAA TTCTGATTAGAGTAGGATGTCAACCTGGATTCTAGAAATAATGGATAACA TTCCAATTTGATCTGTCATTAAATATGGAATGACCTTAAAGACCAGTAAG GTCTTGTGAAAATTTGAATAACATTAATCACATAAGCCTATGTTTTCTAC AGCTTACAATTTAATATCAGACAGGGATGTTTAAAGGCAGATGTATTCCA TTCAAAGTCTTATGCTTGACTTTTGTTCATGCATCACCACACAGGGGTGC CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGGTAAAGG AAGGAATACAAATCTAAACTAAATGTACATGTAATTTGTGTATGGCCATC TTCAATGTTTGCTTTCGATCAGTTTGTAACTTCTACATCAACTATGTTAC AAATACCAATACTGGTCCAGTGGTCTTATTCCTCCTGTGTTCTTTTCTTT CAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG GAGGAAGGACAGGAGTTAACAGGTGGGATGGATTACATATATGTAGATGG CTATGGGCAATGATGGAGTCAACTATAGATATTTTTATTAGATATTGTTT CCATATGGAACTTCATGAGTGGATACATTATATGCTAATTTGATAAGTCT ACCACAATTAGTAGAGACTAAATATTGTCAAACAAAAAGTTTATCATGCA TTTAGTTCTGCTTAAAATGAAAGTAAACACATTGACTGTAGTACTGTTAC TCTTTCTTTAGAAATCAAGGGAGCTGTACTTTTAAGCAGATTCTGGTCGT ATATTTCTGCTCTTGTAAACTTTAAAGTAAGATTTTATTACTCTTACACA GGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAA CGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGA TGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGT TCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCA AGGAAGCTGTGTGAAGGTATGTTTTTTTCATATCAAATTCTACATCTTAA AAATTCTGATGTAACATTAGATTGTTAGAAAAAGCTTAGATGGTTGATTA CTTGAGCAGATGCCTGCAAATTTTGTGAGAAAATTACGTTAAGAATTGCA ATGTACAACCTGACACTAAGATTGTATATTTCCATAACTACTAGATTGTA TATAATGTTACTTTAATTTATGCTTTTAGAGCTTGTAAAATGTAAAGAGA GAATCATGCATGGAGGGAACATACTTGTAAAATGTATATAATGATATTTT GTCTGTCTAATGTCATGATTCAAGATTGTCTGTACTTTTGTCAGTTGGTG TGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTC CTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGAC CACCGTGTGTTCCATATTCTTACCTACTGTATTATAACATCTTATTTCTT TATGGAAAATCCTGTTTATGATAATTTGCTTTCCTGAGTAGTTAATTGTC TCACATTGATATGTTTATTGAACAATAGTTGAGCAAAGGTATGACTACTA CATGTATATTGTTAGGATTATCTTCAGGCAGAACTTATCTAAAAATATTC AGTGCTACTTACATTTTTGACAATGTCAATACTAAAACAGAGCTAGCAGT GGTTGTGACTGTAATACAAGACTATGGAACTAGTGTTTCTACCCTGGTAT CTCATTGTTTTGAAACTTTCCATGCAGTTTTTGACGGGCCTTCAAGATAT GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGGTATGCAA TGCTCCCTGTATTAACATTTTCATTTTGATTTGGATTTATCCATTATATT GTGTGGCACATTTCATACACTGAATCATATTTTGTGAGGAAAAAATGGCC AAAGTTCTTATCATGCACTTTTCTTATCATGTTTTCTCCATGTTTTCTCC ATTATGTAATAGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA TGACCAGATTGGTAAGGCTGCTGCATTAGTTTTAGTTTTCTAACTTGTAG ATTTTTGTTGAAACAGTCATTAGTTATCACATTTCATCACAAAACTAACT AACAAAAAGAATTGATAATTTTAAACAGCTCTGACACCTTAAGTTACTTA TTTACCAATTCAAGATTGGTACAGGGACCCTCACAGTAAGTTTAAAGAAG AATCACTTTGATGAGATAAAGAAAATTGATTGATTGATTGATTAAAATTG ATTGATAGAAAATCTATATACTAAAAAAACTACCAAAGAGACCTTGAAAT AGATTTGCGTTAATAGGGAGTAATGAGCTGTTTACGTGACACATTCGTTT CTCTGTCTGTAGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACA GTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCT AGCCAGCAGTGTTAAACTGAATGTGAGTAAGAGTAATACGTTTTTTCTTC TTTTCCAAATATGCAACTGTTTTGAGTGCCTGTAACAGAGGAATATGTAT ATCATCTCTTCACAATGTTTGAAATGTTGTTTATTCGTTGCTACTACTAT AATATAGCTACATGTAATTCAAGGATTGATGCCTACCTACCTGGGGCTTT GTTTAAAATGAAAAAGCCTGCAAAATAGTTTTCCTTTGAGCTTATCACAT GGGAACAGTTGATTTTAAGAAAATATTATTTTCTAGGTTCTCCGTATCTT CATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTG GGTAAGTACAATGTAACACATTATTTTGTTCAACTTTTCTGAACAAGAAC TGCTGATAATCACATATTCTGCAGAGTCTAACCATAATCATATCTTTATG GGGAACAGAAACTCTCACCAGGAAGTAGCATTGTTGCTTACAAATGAATG TTTCTAAAAAGCCTAATTGGTGAAGAGGAATGCCTTTTTTCACCTTAAAA CAAAATCAATGTACAACCATTATGCTTTCCAAATGGTTGTAAGCCGTATA GATGAAATGAATATGTCTAAAAAGTCAAATTGGTGAAGAGGAATACCTTT TTTCACCTTGAAACTAAATCGATGTACAACAATTCTATTTTCAGCACCAC GGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTG TACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATG GTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGG TTAGTATCACATTCTAATTATTTACAAGATCAGTTGTTGATATGAACATA GTTAAGAATGTTTGCCTGCTATAAGTTTTTAATTCAGTAACCTGTCTCCT TCAAATGCGCCGTGCAGATAAAAACTTTTCCAACAAAATGTATTGTACTT TGGACTTACATCAAGCGTTAAGGTGCAATTGATGATGTAGCATAACTTGA AGAATGATCTTGTAGGACATTATGGTAATGTTTGCTTATTTATCTATCTA AAGATGGATACAACTTAAGCACAGGTTAGGACATAGATAATGGTTTATCA ATTTTCCCTTGTCTTTCTTTTGATATTTGGCCATATGGATCTTCATATCT TGGTTTTGTTCCAGATAATGTGTGTGAGTCATGCTACATTGTACTTTTCT GGGGAATAGTGATAGAATCATTATCAAAAAATGTGTTGCAGCGCCCCGGT GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC CCAATTTGAGTTTGGACAAGATGCAACAAGGTAATAGCTGCTGACAAATG TGACATGCATGTATGTGACCATGCTATTGCTGAGTATCAATAGTTTCCAC ATGATATCATAATGAATTGTGTATATGCAGTGAGGAAGCTACTGTCAGTG AGAGGTTTACAAGCTATATTATGTAATTTTTTTGTTTCCTAATATGTCAA CAGATAGTTGGTTTAATCATTGATACCTTTTTACCCAATCCATGTTGTGT AGAATTGATTAACATTCCTTTTTTCCAAATAAGATGTGACCTGTGTTTTC TTTTCTTCAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG AACTGGTCAACAATGCATTCAGGTAAATAAATACATTGTGTTTCTCCTGA TGTGTTCTGCCTATATTATCAACAAGAGTGAACTTTTTGGCAATCATATA GCAAAGGAAAGTTAAGGAAAGTTTAAGAGAGGAATGTCAGAGAAGCCTAA ACAAATCTGAATAACTAAACATAAATAAGATAAAAACAGCACATAGAAGG ACCAAATATACCCCCTAAAAGAATTCTTGCTTCTTCATAGCTGATGTTCA TGCAATGTTTTTCTTTGCTGTTCCTCTGTATGATAAAGTAGAAATATCCA AAGATTCACGATACTTATTTCAGAATACCTATTTGAAAGTGTTGCAAACA TACTTTTTGAAGTCCATATATGNTAGTTGCAGAATACCTAGTAGACTTGA AAGTGTTGCAAACATACTTTTTGAAATCCATATATGACTGTCCATTCAGC TTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCAC TGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGA CTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAA TCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACT GAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCT GTGATGGTGAGAAACTGCCGGCATTTTTTTACTTTCCTTCCTTGTTCTCT TTCAAAATATATGATTGTGTGATATGTGTTTCTTTCTTTCTGTCTCAATG TAAACGTCTATCTATTTTACTGGGCAAAGCTCTCATTCAGGGGCACCCTG CCCAGGTGCATGGCAATAGTGTGGCCACTTGCCAGTGGTGGTGGTGCTGA AATAGAAAAGAATTTATATTGATTCTGAAAATTCTGGTAACAAAACTCTG ACAGTTATAGTTTCACATCTTACATCCCATTTCACTTCGTCTTCTTCAAC AGGACACCGGTTTCTTCCATCCTTCTTGGTCTCCTGATAGTCTTATTGTG TCTCAATAAAATGATAAATCTACACAATGATGTAACCTGTTGATATATGT ATATTGATATGCTTACAATCATTCTGTATGATCCATTGAAAAATTATTAG GTGTATATTTTCCTTCTACTCCATCTATGAACTTAATTGTTTGTCTCTCC TAAATTACAAATTATTGATGTGATAAAATTTGTTGATTAATGTATTCATC ACATTGGACCACATTATGATTACCAGAGACTGAGTCATTAATATAATGTT TTGCTGATGTTATGATTGTCCTAATCAGATGGCAGCAGTGTGGTTAGTGT GGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGA CATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGGTAATG CTTTGACAGGCAAAGTACTGACTCGTTGAGCTGTTTAAGCAAAATATTAT GTTTGCTTTGGAATTGAATTGCCTGAAAAATAAATCACAACGTTTGTAGA AATGAATATGTATAACTCAATATGTTTGCAAAAATTACCCCATGATGATT TTGAACACAGGAGAAGCTATTCCAATGTTCACATTTATTTCTGGTTTCTC TTGATTCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGT GAACGTCAACTTCCAGCTGAGGTAAGCGTACAGAACTTGTTGGCAGGCTA GCTGCAAAATTTTCATGTGGACATTATATCTTCATGATGAATGTTTTGAG ACATGCTAGGCTAGGATTCCTGGCATTCCTAGCTGAAAGTATTGTCTTAG GGGAATGATACACTACACACATTTGTTAAATTGGGTACCTGCCTTCCAAC ACAGTGCCCTAGAAACAGTGGATTCACAAGTTACTGCCTCTACGGCCTCT AAAAGACTATTGGACCTTTACCTTATACTTTTTCTTGTACAGCAACATAT GTATGCAATCATATACTAAAACTAAATGTGTTTTATTCCCCAAAGCATGA ACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTC AATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGG CAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTAATATTGACT ATGATGATGAATGTCAACTTTGTACAGCTACTATAGCCTGTTTATCTGCC AGTCATTGTCATGTATGTAATTTCTTATTTGCTTAAAATGGAAGTATATA ATTCGGGAGGATAGCCGCCAGACTGAGTTTGATAACTAAAACACCCTAAT GCTATGCAACAATGCAAGGAATTACAACTGTGCTGGACAGTGCAGTGCAT ACTGATTTTTAAGCCATATTGCAACTTTTAAAAGCAGTGACAACACAGAT TTCTCCTGAAAATGCTTTGAAAATTATGGTATCTAAAGAATCGGCACATT TTGGAGTTGTTAATTATATAGCTGTTACAGGGATGCTGTTGTACTACAGT TTGAGGAATAACAGCAATATTTTCTTCCTATGAATTTACAGGTCCTACAG TTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGA GGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCA GGTAAGCTGATTTCACTGTTCATTAGGACACACTGAATCAGTAAAACTAA AGGGTCAATGTATAGCTTTTCTTTTTCTTTTAGGACAAAATCTAAGGATA AGTCCACCAGAGCATCTTATAGTTTTTGCTTAGTAACACCTTTTTAAAGC ATTTTTACAATACAATTTTCAAGAATGCTGTCTTTCTCTGTGGTACTGAT AGCTCTGTGTACTATAGTGTTATGTCTAAAGACTTTCTGTGAGCTGTGAT GCTCTAGCTGTTATAAAATGAATAGTCCGGTTGATAAAGATGATTTTTGT AAGAACAGTGATGAACAAATCCGGTCATTTAATGCTGAATATACGATTTT AAGGTTACCCACATCAACTAATGGCTCCTACATTTCACAGTTGCTGCAAA GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGG TAGGTCTCATCAGAACTTTACATGATGACAAGAGGCATATGTCGTTACAA TCTTAAAATTTTTCTGACGATAAGCCATGTAACATATTATACGTAATACT TGGTTTCTTATATTATACATGCTCATTAACCTCCATGTATAGTAGAGAAA GGCTTGCCAAAAATTTTAACATAGTTGAGCATTTAACAAGAGGAATCTTA TTAAATGACATACATGCCACTTGGAGATGTTGATTCATAAGATCCAGTAC CACACAGAACAACAACTCCATAACTTGAAAATTCAATGACATTTTCTTGC TTTCATTCATAAGAAGTTGTCCATTATCAACAGCCATTTCATTTTCTATA GCCTGAGGTCAGATCTATGTAGAAAGATGGATAATTTGTCCCTATCTTGG GTCCTATGCATCCCCTTGTGATCATCACAATAGCTGGTAAATGTAACGTC CAAGTTGGGTACATGTACAGGAGTGCAGGAAAATAGGGATTGATATCTGA GCGATTTTCTTGCCTGTTTCATTACAGATATGCAGCGACGACGACACTTG TGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACC AACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACT CAGTCCAGAATGTAAGACTGTTGTAGCAACTTTTAGATGAGCACTATTAT ATAAAACAAAACTTTCTCACACCCTACCCTACACTATATTTGTTAATGTT AAGTTAATGTTAAGTAATTTCCTTTGTAATTTGTTATGATTTTGTAAGGG CTCCTTTGGAAATCCATTACTCATCTAACTGAAGAGATTACCTTAAAGAA TATATAATTTAATAGAAAAACCATACAACTACTTATAATCACTTGAAAAT AGTTTAGTTGCTGTGGATACACTGTAACGTTCATGACAAGGAAATCAAAA TTATCAAACTTCATACATTTGCAAGAGATTTTTATATCGGATGCATTTGT CATTACCATGGGATGGAACTACTCATCATGTTTTATTTGTCAGCAATTTT CTAAATCGTCTTCTTCTTCTGCAACAGTCCCCTTGTGTCCTGCAAAGATG GAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTT CCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCG GACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATG CAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGC TGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCAC TGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCT GGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAG TGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATG TTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGA GGCACTCCGGACAACATCTTTGGTCTGGGCGACTTTGGGCAGCTACAGGA TCTCAGCAACCGCCTACCAAACCGCCTTTGTGAACGTATGTACCTGGTCC GGTATTTGCTAGATATATTCATCTGCCAAGAGATCATTACACTTTGACAA ATATTTAATACCTTGAGCTGATTTTGATATACAATGTTCAAATTTTCAAA CAGAAAAATGATGACATTCTACTGAGAAAGAGATTTAAGAATTTCAGGAA GCATTGCAAGCAATGATTCTGACAATTGTAGTCACTCTGGGCAACTTTGG GCAGTTACAGGATCTGTAAAATTTGAAGATAATGCAAGAAAGATTTGACA AAACCTATTTTTAACTGGATTCGACTTTTATGGCTTTCTTTCAGTCGGAA GAAGTACCAATCTAATCCTGTCTCTTGATGTTACATCTGTGCCCTGCTCT TCCATTTTACGACAGCAGTTTGCCTGCCTTCAGACCGCGGTAAGAAAAAA AAATAAATTCCAAAGTAGTGCTAAATGTACCATTAATTTTGGTGTAATAG TGTCAGATCTAAACCTTTTACTTTTTGGGATAGAAATTTTGTCAAGCATA TTGCACAATGATATAATAAGATAATATTGTATCTTAATAACTGCAAAAAC TTTAAAATTTACGCCATAAACTACTGCATGTAGTTAATCTACATGTAAGA ATTTGTATTGGCTAAAGCGGCTCACTGTTATTTCAAGTACATGTACATCT ATTTTGGGTTCATAGCTCAACCTGGCAGGACTTTCCTACCAGAATGGAAT TCTTTCAGTGGCACCGATTAATCTTGTTCGGTATGTAGAAGATTACACAA GTTTAACACTTGACAAGACGTGGTGGAGGGTAAATCATCAAGGTTTAGCA CAGGAAAGTACACACTAGTTTCATTTGATACTAATCCAGATTGGGGAGTA AATGATAAAGCTTTTTAGTACTGTTGAAGAGTGGAGAAATTGAGTTTTAC GCAGACATGTCATCCAAGATAATAATTGAAAAAATGAATTGAAGGAAGTA AGACAGGATATTTGGCAGCCGTGAACACTTGCATAATACCATAAAACTGT CTTTCAACAGACCACTGGAGTACAGCTATGTTTTCCGGTTGGTTTTCTCC CAATATGCTCGAGTTGGCATCACAAGTGCTGTAAATCCAGCCACAACTCA GCTAGGAAATCTGACAGTCGCATCAGTGAATGTCAGAGATGATGGTAAGA ATGCAGGTTTCATGTGGCTGATACTAGGTAAATNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAAGACCAGGA GTTTGGCAGCTGTGAACGCTTGTATAACGTTAATACCATAAGACTGTCTT TCAACAGACCTCTGGAATACAGCTACATCTTCCGGTTGGTTTTCTCCCAA TATGCTCGAGCCGGCATCACAAGTACCGTAAATCCGGCCACAACTCAGCT AGGAAATCTGACGGTCGCATCAGTGAATGTCAGAGATGATGGTAAGAATG CAGGTTTCATGTGGCTGATCTGTGCAATATAAAAATTTGCCAGAATCTTT AATTTGTTTTTTGTTTGCTGTTTATTGTACATATGAGAACGACACATCAT TGCCATTGTTGGTCTGTATTTTTGGGCGTGTCAATTTTCCTGTTATACAT GATAAGATGTACTCATAAGATATGTTGATTACTGTGCTCTAATTGTATGT GTAGTTTGTAATCCATCTATGGCTTTTCTCTAGACTCCCTGCCGCTCTTT GTGATGGTCGAGGTCAACTACACTTACATCCCTGGAATGGATCAGCCAAA CTCTGCAGTGTTTGCCTACTGGACAAACGTTTTTGAAACAAAGGTACACT TCATTGATAATGGTTGAATAAAAAAAGTGTCATTGCTTTGTCCTAAACAA GCATAATCATTGTATTTCCAGATCTGTACATTTGATATCGGTCATTATGG TTATGGCGTACACACATGTGTAGGTTACTAGTAATTCATGGGAACAATTT AATGTATATAAGTCAGTACTAATCTGATGAATTGAATTGTGTCTTCTATT GTACGTTGTAATTTGTACATGTAACTCTATCATTTAGTGACTTTTACCCA AAGTTTGCTAATGTATTTTTCAGGAACAGAATCATATTCAAAATGAACAA ATCCTTCCTTTTCCTCCAACAGTTAACTGGGCTTGAAAATGTCACTGGAA TACTGTCCGTCATTCCAACAGCCTTCAGACCAGGGTAACTATCTCTTTAG TGCAATTTTCCAGATTTTTTTCATGCATCATAGCCTGTAGTTGATGAATG CTGTTTAAAGAACTGTACCATACAATGAATGTTAAAAGCACATCTTCAAG ATAATTAAATGTCAAGGATATGGTTACATACATGTGTCTTAAGCAGTAAA ATTGTTTACTGGTATCAGTATTTCAGTCCTACGTATACATTGGCCGGGAT TCAAACTCTTGACCTCTTGGTCCAAAGGCAGAGTTGTTTACTCTTAGAAC ATGCACACAGGCTACTGAGAGTTAAACTGAACATGTAAGGCAGCTAAGAA TGTTGCTTTTTAGGCATAGAACATAATGATTTACCTTTTTAGTGTATATT GAATTGTTAAAAAGTGATGTTTTACATGGCAACAATTGTGCTTTTTCAGG AATATAGCCACGAGTACCATTGCAGACGTGACATTAGTCGTCTCCCAAAC AGCGAGCATGTTTGTCCAAACTGCACTGGTGGCAGGGTTCAGGTCTGGGG ACATTGATGGTCATCCAGTCATCGATGGGACTGTTTCCACAACAGGTAAG ATAGATACAGCATATACCATACACCATACACCAATATATAAAATATACAA AACTAAACTTTCCTCGCACTCTACCCTGTAATGATTTTGTAAGGGCTCCT TTGGAAATACGTAACTCATTTTACTGAAGAGATTACCTTAAATGATATAT AATTTAATAGAAAAACCATACAACTACTTATAATCACTTCCTACATTCAA CAGAATGTGCCCTGAAAATAGTTTAGTTGCTGTGAGTACACTGTAACATT CATGACAAGGAAATCAAAATCATCAAACTTCATACATTTTTGCAAGAGAT TTTTATTTCATGCATTTGCCATAACCACGGGTAACGTTACTACTCATCAT GTTTTATTTGTCAGCAATTTTCTAAATCGTCTTCTTCTTCTGCAACAGTC CCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGG TAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAG TTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTC CAGTACAGCAGCTTTGTCATGCAGGAATTTGCCCTGGACACCTACGGATC CATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGG GGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCC TTTGGTAATGGTGGCCGCCCTGGTACACGGAGGGTTGCCATTCTCTTGAC GGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGC AGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATG GATGAGCTACTGGCAATTGGAGGCACTCCAGACAACATCTTTGGTCTGAG CAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGT GTGAACGTATGTACCTGTTTGCTGATCTACTAATCTGCCTGAACATCATT ATATTGTAACAAATATTCAATCAATTGTCCTGCTTTTGATTTACAACGTG CAAATTTTTATATCCGATTCATCAGATAGAAAAAGTGAGGCAACTAAAGA GTTGCAACTAGATAACAGATAAGAAGTTTAATAAACATGGCAAGTAATGA TTGTGATATGATCTGTAAATTTCTCTGATGATTTTTTCTTGTTGATGATC CTGCATGACATGCAAGATAGTTTTGACATCATGATATATTGTATTCAACT GAACTGAACTCAAATTTTCTGGCTTTATTTCAGTTGGAAGAAGTATGAAT CTAATCCTGTCTCTTGATGTTACGTCTGTGCCCTGCGCTCCCATGTTACG ACAGCAATTTATCTGCCTACAGACAGCGGTAAGAAAAAGAAAAAAAAGTT CTAAAAATGAAGCATAGTGCTAATATATTATCTTGGGTGTAATAACATTA CGTCTAAACTTGTTACTTCCTGCATACTATTAGTTATGTCTCAAACCATT ATAGTAACATATGACCATAGACTGAGGAAATGTGCAATGTAAATGGTAGT CATGATCAATCTCTCAAGAAAGATTTTATCATGCATCATGTTGTACAATT GCTTGTGCTATGGAAACTTTTACATCGTAAAGTACTGCATGCTGTGAATC TGCTTGTTAATATAGAATCTACTTTGTATGTTGATTAAAGTTGGATACAG TGATCTAAAATACATGTTTGTTGGCTCCATAGCTCAACCAGGCAGGACTT TCCTACCAGAATGGAATTCTTTCAGTGGCACCGATTAATCTTGTTCGGTA CATACAAAGTTTTACACAAGTTGTTGTGGTGGAGGAAAAATGACAAAGGT TTAGCGCTGGAAAGCACACGCTACTTTTATTTAATTTTTGAATCCAGAGT GGGAAGTAGATGATAAGGGTTTTAGTTTCTGGTGAAAAAGGCCAAATAGG GTTCCTTACATATCTCATTGTTTGAACTTGATATGTTTTTTACAAGTGGA AAATTGAAATGACTTGACTCAAATTTATATCCCAAGACTGGGTATTTGGT AGCCGTGAACACTTGCATAATACCATAAAACTGTCTTTCAACAGACCTCT GGAATACAGCTACATCTTCCGGGTGGTTTTCTCCCAATATGCTCGAGCTG GCATCACAAGTGCTGTAAATCCAGCCACAACTCAGCTAGGAAATCTGACG GTCGCATCAGTCAATGTCAGAGATGATGGTAAGAGTGCAGGTTTCATGTA CATGTGGCAAATACTAGTAGATAAATCTGTACAATATAAAAAAGAATTCC AGAAACTGCTTTATTTCTATGTTACCTGCAGGCATACTGTATGTTCATTG TGCATGTGGCACATCATTGCCATTGTTACTTTGTAGTTTTGGACTTGTAT GGGACTTTTCCTGATATAGAGCTGGTAAAATGTACTCCCAGATATCTTGA TATAATAAGTCTATGTGAAGTTTGTAATCCATCTATGGCTTTTCTCTAGA CTCCCTGCCGCTCTTTGTGATGGTTGAGGTCAACTACACTTACATCCCTG GAATGGATCAGCCAAACTCTGCAGTGTTTGCCTACTGGACAAACGTTTTT GAAACAAAGGTACACTTCATTGATAATGGTTGAATAAAAAAAGTGTCATT GCTTTGTCCTAAACAAGCATAATCATTGTATTTCCAGATCTGTACATTTC ACATCGGTCATTATGGTTATGGCATTCACAATCACACATGTATGTTACTA GTAATTCATGAGAACAGTTTAGTTTATAAAAGTCAGTACTCATCAGATGA ATTGAATTGTGTCTTCTATTGTACATTATACAATGTCATGTAACTCTATC ATTTAGTGGCTTTTACCTAAAGATTTCTAATGATTTTTCAGGAACAGAAT CATATAAAAAATTAACAAATCCTTCTTTTTCCTCCAACAGTTAACTGGGC TAGAAAATGTCACTGGAATTTTGTCCGTCATTCCAACAGCCTTCAGACCA GGGTAACTATCTCTTTAGTGCAATTTTCAAGACTTTTTTCATGCATCATA GCCTGTAGTTGATGAATGCTGTTTAAAGAACTGTACCATACAATGAATGT TAAAAGCACATCTTCAAGATAATTAAATGTCAAGGATATGGTTACATACA TGTGTCTTAAGCAGTAAAATTGTTTACTGGTATCAGTATTTCAGTCCTAC GTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCCAAGACCAGGAGTTTGGCAGCTGTGA ACGCTTGTATAACGTTAATACCATAAGACTGTCTTTCAACAGACCTCTGG AATACAGCTACATCTTCCGGTTGGTTTTCTCCCAATATGCTCGAGCCGGC ATCACAAGTACCGTAAATCCGGCCACAACTCAGCTAGGAAATCTGACGGT CGCATCAGTGAATGTCAGAGATGATGGTAAGAATGCAGGTTTCATGTGGC TGATCTGTGCAATATAAAAATTTGCCAGAATCTTTAATTTGTTTTTTGTT TGCTGTTTATTGTACATATGAGAACGACACATCATTGCCATTGTTGGTCT GTATTTTTGGGCGTGTCAATTTTCCTGTTATACATGATAAGATGTACTCA TAAGATATGTTGATTACTGTGCTCTAATTGTATGTGTAGTTTGTAATCCA TCTATGGCTTTTCTCTAGACTCCCTGCCGCTCTTTGTGATGGTCGAGGTC AACTACACTTACATCCCTGGAATGGATCAGCCAAACTCTGCAGTGTTTGC CTACTGGACAAACGTTTTTGAAACAAAGGTACACTTCATTGATAATGGTT GAATAAAAAAAGTGTCATTGCTTTGTCCTAAACAAGCATAATCATTGTAT TTCCAGATCTGTACATTTGATATCGGTCATTATGGTTATGGCGTACACAC ATGTGTAGGTTACTAGTAATTCATGGGAACAATTTAATGTATATAAGTCA GTACTAATCTGATGAATTGAATTGTGTCTTCTATTGTACGTTGTAATTTG TACATGTAACTCTATCATTTAGTGACTTTTACCCAAAGTTTGCTAATGTA TTTTTCAGGAACAGAATCATATTCAAAATGAACAAATCCTTCCTTTTCCT CCAACAGTTAACTGGGCTTGAAAATGTCACTGGAATACTGTCCGTCATTC CAACAGCCTTCAGACCAGGGTAACTATCTCTTTAGTGCAATTTTCCAGAT TTTTTTCATGCATCATAGCCTGTAGTTGATGAATGCTGTTTAAAGAACTG TACCATACAATGAATGTTAAAAGCACATCTTCAAGATAATTAAATGTCAA GGATATGGTTACATACATGTGTCTTAAGCAGTAAAATTGTTTACTGGTAT CAGTATTTCAGTCCTACGTATACATTGGCCGGGATTCAAACTCTTGACCT CTTGGTCCAAAGGCAGAGTTGTTTACTCTTAGAACATGCACACAGGCTAC TGAGAGTTAAACTGAACATGTAAGGCAGCTAAGAATGTTGCTTTTTAGGC ATAGAACATAATGATTTGCCTTTTTAGTGTATATTGAATTGTTAAAAAGT GATGTTTTACATGGCAACAATTGTGCTTTTTCAGGAATATAGCCACGAGT ACCATTGCAGACGTGACATTAGTCGTCTCCCAAACAGCGAGCATGTTTGT CCAAACTGCACTGGTGGCAGGGTTCAGGTCTGGGGACATTGATGGTCATC CAGTCATCGATGGGACTGTTTCCACAACAGGTAAGATAGATACAGCATAT ACCATACACCATACACCAATATATAAAATATACAAAACTAAACTTTCCTC GCACTCTACCCTGTAATGATTTTGTAAGGGCTCCTTTGGAAATACGTAAC TCATTTTACTGAAGAGATTACCTTAAATGATATATAATTTAATAGAAAAA CCATACAACTACTTATAATCACTTCCTACATTCAACAGAATGTGCCCTGA AAATAGTTTAGTTGCTGTGAGTACACTGTAACATTCATGACAAGGAAATC AAAATCATCAAACTTCATACATTTTTGCAAGAGATTTTTATTTCATGCAT TTGCCATAACCACGGGTAACGTTACTACTCATCATGTTTTATTTGTCAGC AATTTTCTAAATCGTCTTCTTCTTCTGCAACAGTCCCCTTGTGTCCTGCA AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT GTCATGCAGGAATTTGCCCTGGACACCTACGGATCCATTGGTGAGATCAA CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA ATTGGAGGCACTCCAGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA

Coding sequence (CDS) from alignment at Sc0000054:19547..48586-

>transcript:BL97207_cuf6 ID=transcript:BL97207_cuf6|Name=transcript:BL97207_cuf6|organism=Branchiostoma lanceolatum|type=CDS|length=181560bp|location=Sequence derived from alignment at Sc0000054:19547..48586- (Branchiostoma lanceolatum)
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTG
GGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGACTTCACAGCG
CTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGG
CAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTC
TGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTG
TACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGA
CCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCA
TGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCC
GAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGG
ACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAAT
CCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGA
TACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTAC
CATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCC
CAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTA
CAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAA
GCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCC
CTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGC
AAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGC
AGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATA
TTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTT
GATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTT
CCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGA
CCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTA
GAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAG
TGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCA
CCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAG
ATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATT
TGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTC
CAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGC
ACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGA
GCTGCCCAATGGCATCGATGATGACATGGACGGGACTATCGATGAGGCTG
ACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGT
GAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGG
CTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTAC
TCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCA
GCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAG
TGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCC
AGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTC
ATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAG
AGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCT
CTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGA
CTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGT
CACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACC
TAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAAT
GTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACT
GCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGT
CCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAA
GATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACAC
TGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACC
TCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATA
GTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGC
AACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCC
CTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCC
ATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGG
AGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAG
TTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCT
GAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCT
GGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGA
GTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTG
TGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTA
CACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACC
TTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTC
CAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACG
TGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGC
AGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTT
GACACAGCAACCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGG
CTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTT
CAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGT
ATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAA
GCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTG
CTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGAT
TCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTT
ATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTAC
TTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGA
TTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAG
ACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGA
ATTCTTATGACACATTGGAAGACATCAACACAGCAATTGATGGCATGATG
TACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAA
CAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTG
CAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTA
CAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAG
TGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAG
TTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTA
GCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGT
AGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCA
CTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTT
GGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCAT
GAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTG
TCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTT
GGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGT
TCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAG
GCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAG
TTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACAT
CTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAG
TGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTG
GCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTT
GTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTG
TTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCT
GGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTA
CAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTG
GTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACA
GCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGG
TAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATG
GTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCT
GGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGA
GCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACT
TTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAA
GCTGTCCAGCTTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGT
GTTCAGACTCTATACAACATACTACACAGACTTCACAGCGCTGAGCGCAC
GTCTGGCAGGTGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATG
GCAATGTCCAAAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTT
CACAGGGAATGATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAA
GCAGCGGTGGACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGC
TTCCAGACCACTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGT
TCCAAATGATCTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGA
TCTCTGTGACATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAA
GAGCTCTACACCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGG
TACAGAGTATGTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTC
AGTTCACCATCGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCA
ATGGCAACGATTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGA
TCTTACTCTTACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGG
ATCAAGAGGATCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCC
GTGTTCTCTGGTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGG
ACACATCCAGCAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCA
TCATCCATGCAGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAA
TTCACAACAGTCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCT
GTCCATGTGGGAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACT
TCATCATGACATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGA
AGATCGGTGAACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCC
TACTGAGCAGTGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAG
GAGTGTCCAGCACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATC
AGCGGTCTTCGTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAG
GAACATTCCCAACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCG
GCACTTCCAGAATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTC
GTCTACAGCTTGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATA
CCACCTGTCCCCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAG
ATGGGAGGGACAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAAT
GGCATCGATGATGACATGGACGGGACTATCGATGAGGCTGACATGGCACT
TAATCCGTGTGATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCA
GGGGAGGGTACCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGT
GATATTAGCCTTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCC
AGGTTGGATTGCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTA
CTCTGGATGGTGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGG
TACCTGACTTTCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTT
CACTGGTAAGATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAG
TGCATGGAGGCCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTA
CCAGAAATGCTGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGG
TCGTCTCTGGAGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACC
CTCAAGTGTGTGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGC
TACACACTGCTGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACAC
ACAGGGCAAGACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGT
ACTACAGCATGAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACA
GACATCAAACCTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTC
ATCTGCCAGTCAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTG
CTATGGGAACTGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATG
CTAACACCAAGAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGC
TATTGATGGCACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCA
TCAAGAGAGTTGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTG
TCTGTGGCACAGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCA
GTTCCAAAGCCTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGA
CAGACATGCCAGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATG
CAAGGAAATGGAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCAC
TGATGGTGTGACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTG
TTGTCACTTTCACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTG
GAAGCATTCAGTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATA
CGGGCTGGTAGATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTG
GTGTGACCAGCTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAG
TTCCTAACTGCAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAA
GACCACCTTTTTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCAC
AAGTCGTCAACCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATC
CGAGTGATTGCCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTT
CAACATCACAGCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAA
CCATCACATATGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAA
GTCCGCACAGTGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATA
CAGAATGCTAGCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTA
GGCTCTACGGTGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACC
ACGGCTACAACAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGC
TGTACCCAGCATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGA
TGGTTGGAACTCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAA
GCGCCCCGGTGTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTC
GGGCAGTGTCGGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGA
GGCTCACCACCCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATC
CTCCAGTATTCAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGA
CACATTGGAAGACATCAACACAGCAATTGATGGCATGATGTACAAGGGAG
GTGGTACCAACACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTC
AGCTTCCAGAATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCAT
CACTGATGGAAAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCA
AGACTGCAGGAATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGAC
CAATCAGAACTGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGC
ACTGAACTATGACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGT
TCTGTGATGATGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGAC
GAGGACTTCAATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAG
TCTTCGAGCAACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTG
CCAACCTCATCCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAA
GTCAGAGTGGTCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCT
GCAAGTCATCATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGA
CTGTCACTGGTGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGT
ATTATGGAGGTGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAG
CTATGAGGCTGCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAA
GCTTGACTACCAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGA
TATGCAGCGACGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAA
TGTCTCGGATGCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCC
CAATGTTCCTTCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCA
AAGATGGAAGTGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGA
CAACTTCCAACGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTG
CTATCGGACCGTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTT
GTCATGCAGGAATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAA
CCAGGCTGTTGATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGAC
TGGCACTGTACGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGC
CGTCCTGGTACACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATC
TGACAGTGTTGACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCT
TGTATGTTGTTGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCA
ATTGGAGGCACTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCT
GCAGGATCTTGGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGC
TTGTGGACCTCAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTC
TATACAACATACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGG
TGGGGGCGTGATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCA
AAGCATTGAGTACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAAT
GATCCTGCAGACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGG
ACGAAACACCTCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCA
CTGTGACTGTGTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGAT
CTTGTGATGGTCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGAC
ATCAACCGAGGCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACA
CCATCCAGCCATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTAT
GTGGCTGTGATGTACACACCAACAAACGGATACCCAAGTCAGTTCACCAT
CGCAGCTACAGAGGATGACACCACGGTTACCATCAGATCAATGGCAACGA
TTGAGTATGCAGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTT
ACAATCGGGCCCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGA
TCTAAGTGGAACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTG
GTAACCAGTTTGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAG
CAGCAGCTAAAACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGC
AGCTTCAGCAAATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAG
TCACTCTCAGCAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGG
GAGTTTGACTTCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGAC
ATCCACGCAGCCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGA
ACAACATTCAGATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAG
TGGGCTTCCACATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAG
CACACCCAATCTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTC
GTTTTGAAGGTGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCC
AACTCTGATCTGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAG
AATCTGGCACATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCT
TGGCAGCTGATGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCC
CCACTGGCAGTGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGA
CAATGACTGCGACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATG
ATGACATGGACGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGT
GATAGAAACCCTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTA
CCAGTGCCGATGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCC
TTGGTGGGCTGGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATT
GCAGAGGAGGACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGG
TGACAACACCACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTT
TCAACCTCGGCAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAG
ATGCCATCAGACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGG
CCCAGGTGGCAACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGC
TGAATGGTCCGATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGG
AGGCTGCAAGTTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTG
TGAACTGCAGTTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGC
TGCCACTGCAGGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAG
ACAGCACTGGCTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCAT
GAGACCAGATTTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAAC
CTTTGGGTGCCTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGT
CAAGTCATGTACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAAC
TGTCAACAACGTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAA
GAGTTCCTCCATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGC
ACTGTGTCCCCCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGT
TGTGCACACTTTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCAC
AGGGAGGCAGTTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGC
CTGCCAGGGCTGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCC
AGGGGAAGGCAGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATG
GAGGAAGGACAGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTG
ACGGATGCAGCAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTT
CACTGTTGCCATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCA
GTCCATCCAGTAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTA
GATCTCGGCAACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAG
CTACATGGCGGTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTG
CAGCTTCCCCGGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTT
TTGACGGGCCTTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAA
CCTCATGCCTGGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTG
CCGGGGCCTATGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACA
GCAGCTGGACAGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATA
TGACCAGATTGCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAG
TGTTCATGCAGAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTA
GCCAGCAGTGTTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGG
TGTTCGATCAATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAA
CAACCTGGGTTGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGC
ATCGTCACCTCCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAAC
TCTGGATATCCTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGT
GTGGAGTGGAGGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTC
GGGGCAGAGAACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCAC
CCAATTTGAGTTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATT
CAACTGATGTAAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAA
GACATCAACACAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAA
CACTCACTTGGCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGA
ATGGTGCTCGGCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGA
AAGTCCTCCCAGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGG
AATCATCGTGTACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAAC
TGCAGGAGATCGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTAT
GACTCTCTGCTCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGA
TGGCAGCAGTGTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCA
ATATCGACTTGTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCA
ACATTGCTTTATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCAT
CCTTGTGAACGTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGG
TCTTTACCATGAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATC
ATCAACCAAGTTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGG
TGCTATCTTTGATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGG
TGAATAGAACATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCT
GCCGCATTAAGCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTAC
CAGTGTCAACTTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGA
CGACGACACTTGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGAT
GCGGTCCTCACCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCT
TCAAGGATCACTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAG
TGGTTTTTGTCCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAA
CGGATGAAGTCCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACC
GTCAGCCACCCAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGG
AATTCGCCCTGGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTT
GATGTTGTCATGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTA
CGAAATGAGACAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTA
CACGGAGGGTTGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTT
GACAAACATGCGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGT
TGGGATTGGATCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCA
CTCCGGACAACATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTT
GGCAACCGCCTACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCT
CAGTGAAAGTGTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACAT
ACTACACAGACTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTG
ATGGGTGGTCGCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAG
TACATCTGGCCGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAG
ACATGACAAACCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACC
TCAGTCACTGTCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGT
GTCTGGGAGCCAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGG
TCGGAAGTACAACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAG
GCACCTGTCACTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCC
ATTCATTGCTCTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGA
TGTACACACCAACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACA
GAGGATGACACCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGC
AGGTTTAGCTCCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGC
CCAGTACCATCGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGA
ACCTACATCACATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTT
TGCAGAGTTCCCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAA
AACCTGTCAGCAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCA
AATATCTTCAGGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAG
CAATGGAATGACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACT
TCAGTGAGACGACGTCATTTGATCAGTACTTCATCATGACATCCACGCAG
CCAATCCAGGTCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCA
GATGGGCCCAACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCA
CATACAGCCTCACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAAT
CTAGTCCTCTTTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGG
TGGGCGACTGCCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATC
TGTCCTGGGTGATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCAC
ATCAGTCCGCTGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGA
TGGGTCAACTTATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAG
TGTGTGACCGAGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGC
GACGGTCTCTTTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGA
CGGGACTATCGATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACC
CTTGCAGCAATGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGA
TGTGACGAGGGCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCT
GGATGGTCCAACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGG
ACATGGCTTGGGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACC
ACCTGCTGGGATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGG
CAGTTCCTACACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAG
ACTTTGTCCCCAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGC
AACTGGACAGACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCC
GATAAGTTTTGGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAG
TTTCTGACACTCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAG
TTTTTTGGACAAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCA
GGGGACTTACACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGG
CTGTTAACGTGGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGAT
TTTCGGGGCCTGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGC
CTATGTGACTGCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGT
ACCAAGAGATGGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAAC
GTAGCTGTCATCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCC
ATGCACCGTCCCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCC
CCAGCACCTTCAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACT
TTCACCATTGGGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAG
TTCACCAAGGCTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGC
TGATACAAGGTCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGC
AGGAGGTTTAGCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGAC
AGGAGTTAACAGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAG
CAGATTTCCAACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCC
ATTGGTGATGATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAG
TAACTTTGTGTTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCA
ACAGATTGCCAAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCG
GTGACCTTGAATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCC
GGGATTTACTGCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCC
TTCAAGATATGTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCT
GGTCCCGTGTATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTA
TGCATTGGATGACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGAC
AGTTTGGTTCCTACAGCTTTGACACAGCAACCATCACATATGACCAGATT
GCAAATCAGTTCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCA
GAGCTACAGAGACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTG
TTAAACTGAATGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCA
ATGGCAGTTACAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGT
TGACTTCCAGATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCT
CCTACCTGAATGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATC
CTCCCTGGGTCTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGA
GGTCGACCTGGTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGA
ACTTCAATAAGTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAG
TTTGGACAAGATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGT
AAAAACCGTCTTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACA
CAGCAATTGATGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTG
GCCCTCTACGAACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCG
GCCCACAGCCAGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCC
AGCCCATCACCAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTG
TACGCCATGGGTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGAT
CGCAAGTTCTTCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGC
TCTCCCTGACAGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGT
GTGGTTAGTGTGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTT
GTTGAATGTGACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTT
ATCAGCTGAACTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAAC
GTCAACTTCCAGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCAT
GAATTCTCTGGGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAG
TTGCTTCATCTGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTT
GATGCTCAAGGTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAAC
ATTCACATCAGAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAA
GCATCACTTTCAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAAC
TTTGCCAGGGTCACCGACATCTCTCCTGGATATGCAGCGACGACGACACT
TGTGTCCTTTGTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCA
CCAACTTCAACACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCA
CTCAGTCCAGAATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGT
CCTGGATGGTTCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGT
CCTTTGTGAAGAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACC
CAGATAAGTCTATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCT
GGACACCTACGGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCA
TGTACCAAGGCGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGA
CAGTATGGCTTCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGT
TGCCATTCTCTTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATG
CGATGGCAGCCTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGA
TCAAACGTGGACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAA
CATCTTTGGTCTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCC
TACCAAACCGTCTGTGTGAAGCTGTCCAGCTTGTGGACCTCAGTGAAAGT
GTGATGGGTGGGAGTGCTGTGTTCAGACTCTATACAACATACTACACAGA
CTTCACAGCGCTGAGCGCACGTCTGGCAGGTGGGGGCGTGATGGGTGGTC
GCACTGTGGGCAGCAGCATGGCAATGTCCAAAGCATTGAGTACATCTGGC
CGGGAGTTTCTGGTGGCCTTCACAGGGAATGATCCTGCAGACATGACAAA
CCCTCGTTTGTACATTTCAAGCAGCGGTGGACGAAACACCTCAGTCACTG
TCTCTGCAGACCTTGGAGGCTTCCAGACCACTGTGACTGTGTCTGGGAGC
CAGGTTGTCATGGTGGAGGTTCCAAATGATCTTGTGATGGTCGGAAGTAC
AACACATTCCGAAAGAGTGATCTCTGTGACATCAACCGAGGCACCTGTCA
CTGTGTACGGACTTGTCAAAGAGCTCTACACCATCCAGCCATTCATTGCT
CTCCCCAAATCCAGTCTTGGTACAGAGTATGTGGCTGTGATGTACACACC
AACAAACGGATACCCAAGTCAGTTCACCATCGCAGCTACAGAGGATGACA
CCACGGTTACCATCAGATCAATGGCAACGATTGAGTATGCAGGTTTAGCT
CCGGTTACCCCAGCAGAGGATCTTACTCTTACAATCGGGCCCAGTACCAT
CGGTGCCGTACAGATAGTGGATCAAGAGGATCTAAGTGGAACCTACATCA
CATCAAACAAGCCCATTGCCGTGTTCTCTGGTAACCAGTTTGCAGAGTTC
CCGGGAAGCCCTCCTGGTGGACACATCCAGCAGCAGCTAAAACCTGTCAG
CAGCTGGGGCAAGACCTTCATCATCCATGCAGCTTCAGCAAATATCTTCA
GGGTGACAGCAGCCTTTGAATTCACAACAGTCACTCTCAGCAATGGAATG
ACACAGAATATTGATGTTCTGTCCATGTGGGAGTTTGACTTCAGTGAGAC
GACGTCATTTGATCAGTACTTCATCATGACATCCACGCAGCCAATCCAGG
TCGTTGTGTTCCAAAAGGGAAGATCGGTGAACAACATTCAGATGGGCCCA
ACCATGCTGACCTTGTCCCCTACTGAGCAGTGGGCTTCCACATACAGCCT
CACTACCTTAGAACTCCCAGGAGTGTCCAGCACACCCAATCTAGTCCTCT
TTGTCAGAAGTGCCGACATCAGCGGTCTTCGTTTTGAAGGTGGGCGACTG
CCACTAGGCACCGCGTGGAGGAACATTCCCAACTCTGATCTGTCCTGGGT
GATGATGCAGATATCTTCCGGCACTTCCAGAATCTGGCACATCAGTCCGC
TGGCCAGATTTGGAGCTTTCGTCTACAGCTTGGCAGCTGATGGGTCAACT
TATGTTGTTCCAGCTGGATACCACCTGTCCCCACTGGCAGTGTGTGACCG
AGGCAACGGCACAGCAGGAGATGGGAGGGACAATGACTGCGACGGTCTCT
TTGATGAGGAGCTGCCCAATGGCATCGATGATGACATGGACGGGACTATC
GATGAGGCTGACATGGCACTTAATCCGTGTGATAGAAACCCTTGCAGCAA
TGGTGTTTGTGAGGTGACCAGGGGAGGGTACCAGTGCCGATGTGACGAGG
GCTTCTCAGGCTTCTCCTGTGATATTAGCCTTGGTGGGCTGGATGGTCCA
ACATGGCTACTCAGTGACCCAGGTTGGATTGCAGAGGAGGACATGGCTTG
GGAGGCGGCAGCAAATCTTACTCTGGATGGTGACAACACCACCTGCTGGG
ATCCTGGCAGTGGAACCCGGTACCTGACTTTCAACCTCGGCAGTTCCTAC
ACCATCTTCCAGGTCCGTTTCACTGGTAAGATGCCATCAGACTTTGTCCC
CAAATCTGTCATGCTACAAGTGCATGGAGGCCCAGGTGGCAACTGGACAG
ACATCAAGAGAGTGGCAGTACCAGAAATGCTGAATGGTCCGATAAGTTTT
GGAGGTTTCTCTGCAACTGGTCGTCTCTGGAGGCTGCAAGTTTCTGACAC
TCACTCTGGACTTTACAACCCTCAAGTGTGTGAACTGCAGTTTTTTGGAC
AAGAAGTTGTCACCACGAGCTACACACTGCTGCCACTGCAGGGGACTTAC
ACAGAGAACCTAGTCAACACACAGGGCAAGACAGCACTGGCTGTTAACGT
GGAGACTAATGTGCTTAAGTACTACAGCATGAGACCAGATTTTCGGGGCC
TGTATGGACTGCAAGTTACAGACATCAAACCTTTGGGTGCCTATGTGACT
GCAGAGGTGTCCTTCATTTCATCTGCCAGTCAAGTCATGTACCAAGAGAT
GGCTCTTCAAGATGCTGTTGCTATGGGAACTGTCAACAACGTAGCTGTCA
TCAATGACACTGGGATAATGCTAACACCAAGAGTTCCTCCATGCACCGTC
CCAACGGACCTCGTTTTTGCTATTGATGGCACTGTGTCCCCCAGCACCTT
CAGTGCTATAGTGGCCTTCATCAAGAGAGTTGTGCACACTTTCACCATTG
GGCCTGAAGCAACCCAAGTGTCTGTGGCACAGGGAGGCAGTTCACCAAGG
CTAGATTTCCCTCTGAACCAGTTCCAAAGCCTGCCAGGGCTGATACAAGG
TCTTGATGCCATACAGCAGACAGACATGCCAGGGGAAGGCAGGAGGTTTA
GCCATCTTGGAGTTTTCATGCAAGGAAATGGAGGAAGGACAGGAGTTAAC
AGGCTGGCAGTTTTTGTCACTGATGGTGTGACGGATGCAGCAGATTTCCA
ACGTGCATCTGAGAATGGTGTTGTCACTTTCACTGTTGCCATTGGTGATG
ATGCTGACCTGGCCAGCTTGGAAGCATTCAGTCCATCCAGTAACTTTGTG
TTCCGCGTGAGTGACTCATACGGGCTGGTAGATCTCGGCAACAGATTGCC
AAGGAAGCTGTGTGAAGTTGGTGTGACCAGCTACATGGCGGTGACCTTGA
ATGTTAACTACACCACCGAGTTCCTAACTGCAGCTTCCCCGGGATTTACT
GCGCTCAACCTTGCTGTTAAGACCACCTTTTTGACGGGCCTTCAAGATAT
GTTTGGTTTCCAAGCTGCACAAGTCGTCAACCTCATGCCTGGTCCCGTGT
ATAGCACACGTGCTAATATCCGAGTGATTGCCGGGGCCTATGCATTGGAT
GACATTCAGCAGAAGGTCTTCAACATCACAGCAGCTGGACAGTTTGGTTC
CTACAGCTTTGACACAGCAACCATCACATATGACCAGATTGCAAATCAGT
TCCTGTATGGCTACATTGAAGTCCGCACAGTGTTCATGCAGAGCTACAGA
GACCAGTTTTCAGCATCATACAGAATGCTAGCCAGCAGTGTTAAACTGAA
TGTTCTCCGTATCTTCATTAGGCTCTACGGTGTTCGATCAATGGCAGTTA
CAAATATCAAGCCTGGCACCACGGCTACAACAACCTGGGTTGACTTCCAG
ATGAACTGTGCTCAAACAGCTGTACCCAGCATCGTCACCTCCTACCTGAA
TGTCACTGATTCATATCAGATGGTTGGAACTCTGGATATCCTCCCTGGGT
CTGGCTATTTATCCATTGAAGCGCCCCGGTGTGGAGTGGAGGTCGACCTG
GTGCTTGTACTTGATGACTCGGGCAGTGTCGGGGCAGAGAACTTCAATAA
GTTGAAAGGATTTGTGAAGAGGCTCACCACCCAATTTGAGTTTGGACAAG
ATGCAACAAGACTTGGGATCCTCCAGTATTCAACTGATGTAAAAACCGTC
TTCAGTCTGAATTCTTATGACACATTGGAAGACATCAACACAGCAATTGA
TGGCATGATGTACAAGGGAGGTGGTACCAACACTCACTTGGCCCTCTACG
AACTGGTCAACAATGCATTCAGCTTCCAGAATGGTGCTCGGCCCACAGCC
AGCAAGGTTGCAGTCATCATCACTGATGGAAAGTCCTCCCAGCCCATCAC
CAGGGCTGTACAGGAGGTCAAGACTGCAGGAATCATCGTGTACGCCATGG
GTGTTGGCAGTGGCACTGACCAATCAGAACTGCAGGAGATCGCAAGTTCT
TCAGACAGAGTTTTCAGTGCACTGAACTATGACTCTCTGCTCTCCCTGAC
AGGGGGTCTAGCCAATAGGTTCTGTGATGATGGCAGCAGTGTGGTTAGTG
TGGCCACAGTAGATCTGGACGAGGACTTCAATATCGACTTGTTGAATGTG
ACATCAAGCACTTTCATCAGTCTTCGAGCAACATTGCTTTATCAGCTGAA
CTTTGAGCTTGGACGTTTTGCCAACCTCATCCTTGTGAACGTCAACTTCC
AGCTGAGCATGAACGACAAAGTCAGAGTGGTCTTTACCATGAATTCTCTG
GGATACATTGTCAATGACCTGCAAGTCATCATCAACCAAGTTGCTTCATC
TGGAAACTTTGGCAACTTGACTGTCACTGGTGCTATCTTTGATGCTCAAG
GTCCTACAGTTCTCTATGGTATTATGGAGGTGAATAGAACATTCACATCA
GAGCTCCGAGGCATTTCCAGCTATGAGGCTGCCGCATTAAGCATCACTTT
CAAGTACCAGTTGCTGCAAAGCTTGACTACCAGTGTCAACTTTGCCAGGG
TCACCGACATCTCTCCTGGATATGCAGCGACGACGACACTTGTGTCCTTT
GTTACTTCAGTGAGTGCTAATGTCTCGGATGCGGTCCTCACCAACTTCAA
CACTTCTGTGGCTGCTACCCCAATGTTCCTTCAAGGATCACTCAGTCCAG
AATTCCCCTTGTGTCCTGCAAAGATGGAAGTGGTTTTTGTCCTGGATGGT
TCTGGTAGTGTTGGCTACGACAACTTCCAACGGATGAAGTCCTTTGTGAA
GAGAGTTGCTGGCAGCTTTGCTATCGGACCGTCAGCCACCCAGATAAGTC
TATTCCAGTACAGCAGCTTTGTCATGCAGGAATTCGCCCTGGACACCTAC
GGATCCATTGGTGAGATCAACCAGGCTGTTGATGTTGTCATGTACCAAGG
CGGGGGGACAGCCACAGGACTGGCACTGTACGAAATGAGACAGTATGGCT
TCTCCTTTGGTAATGGTGGCCGTCCTGGTACACGGAGGGTTGCCATTCTC
TTGACGGATGGTATGTCATCTGACAGTGTTGACAAACATGCGATGGCAGC
CTGGCAGGCTGGGATCAGCTTGTATGTTGTTGGGATTGGATCAAACGTGG
ACATGGATGAGCTACTGGCAATTGGAGGCACTCCGGACAACATCTTTGGT
CTGAGCAACTTTGGGCAGCTGCAGGATCTTGGCAACCGCCTACCAAACCG
TCTGTGTGAA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97207gene:BL97207Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97207_cuf6transcript:BL97207_cuf6-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97207_cuf6-E1BL97207_cuf6-E1-1564476830-232664Branchiostoma lanceolatumexon
BL97207_cuf6-E2BL97207_cuf6-E2-1564476830-232661Branchiostoma lanceolatumexon
BL97207_cuf6-E3BL97207_cuf6-E3-1564476830-232659Branchiostoma lanceolatumexon
BL97207_cuf6-E4BL97207_cuf6-E4-1564476830-232657Branchiostoma lanceolatumexon
BL97207_cuf6-E5BL97207_cuf6-E5-1564476830-232655Branchiostoma lanceolatumexon
BL97207_cuf6-E6BL97207_cuf6-E6-1564476830-232653Branchiostoma lanceolatumexon
BL97207_cuf6-E7BL97207_cuf6-E7-1564476830-232651Branchiostoma lanceolatumexon
BL97207_cuf6-E8BL97207_cuf6-E8-1564476830-232649Branchiostoma lanceolatumexon
BL97207_cuf6-E9BL97207_cuf6-E9-1564476830-232647Branchiostoma lanceolatumexon
BL97207_cuf6-E10BL97207_cuf6-E10-1564476830-232645Branchiostoma lanceolatumexon
BL97207_cuf6-E11BL97207_cuf6-E11-1564476830-232643Branchiostoma lanceolatumexon
BL97207_cuf6-E12BL97207_cuf6-E12-1564476830-232641Branchiostoma lanceolatumexon
BL97207_cuf6-E13BL97207_cuf6-E13-1564476830-232639Branchiostoma lanceolatumexon
BL97207_cuf6-E14BL97207_cuf6-E14-1564476830-232637Branchiostoma lanceolatumexon
BL97207_cuf6-E15BL97207_cuf6-E15-1564476830-232635Branchiostoma lanceolatumexon
BL97207_cuf6-E16BL97207_cuf6-E16-1564476830-232633Branchiostoma lanceolatumexon
BL97207_cuf6-E17BL97207_cuf6-E17-1564476830-232631Branchiostoma lanceolatumexon
BL97207_cuf6-E18BL97207_cuf6-E18-1564476830-232629Branchiostoma lanceolatumexon
BL97207_cuf6-E19BL97207_cuf6-E19-1564476830-232627Branchiostoma lanceolatumexon
BL97207_cuf6-E20BL97207_cuf6-E20-1564476830-232625Branchiostoma lanceolatumexon
BL97207_cuf6-E21BL97207_cuf6-E21-1564476830-232623Branchiostoma lanceolatumexon
BL97207_cuf6-E22BL97207_cuf6-E22-1564476830-232621Branchiostoma lanceolatumexon
BL97207_cuf6-E23BL97207_cuf6-E23-1564476830-232619Branchiostoma lanceolatumexon
BL97207_cuf6-E24BL97207_cuf6-E24-1564476830-232617Branchiostoma lanceolatumexon
BL97207_cuf6-E25BL97207_cuf6-E25-1564476830-232615Branchiostoma lanceolatumexon
BL97207_cuf6-E26BL97207_cuf6-E26-1564476830-232613Branchiostoma lanceolatumexon
BL97207_cuf6-E27BL97207_cuf6-E27-1564476830-232611Branchiostoma lanceolatumexon
BL97207_cuf6-E28BL97207_cuf6-E28-1564476830-232609Branchiostoma lanceolatumexon
BL97207_cuf6-E29BL97207_cuf6-E29-1564476830-232607Branchiostoma lanceolatumexon
BL97207_cuf6-E30BL97207_cuf6-E30-1564476830-232605Branchiostoma lanceolatumexon
BL97207_cuf6-E31BL97207_cuf6-E31-1564476830-232603Branchiostoma lanceolatumexon
BL97207_cuf6-E32BL97207_cuf6-E32-1564476830-232601Branchiostoma lanceolatumexon
BL97207_cuf6-E33BL97207_cuf6-E33-1564476830-232599Branchiostoma lanceolatumexon
BL97207_cuf6-E34BL97207_cuf6-E34-1564476830-232597Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000054genomeSc0000054:19547..48586 -
Properties
Property NameValue
Transcript idBL97207_cuf6
Biotypeprotein_coding