Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97201_cuf0 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97201_cuf0
Unique Nametranscript:BL97201_cuf0
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97201_cuf0

>transcript:BL97201_cuf0-protein ID=transcript:BL97201_cuf0-protein|Name=transcript:BL97201_cuf0|organism=Branchiostoma lanceolatum|type=polypeptide|length=116bp
MPPKSDKISDDPRVYIYGDTKLMMELRSAPYDPKKNVWAPDDKDVYIAVE
IKEEKGDKITVQLPKGQTKEVKKDKIVMMNPPKFVCCEDMANMTYLNDAS
VLATLRDRYANGMIYV
Run BLAST on NCBI

mRNA from alignment at Sc0000733:6208..7987+

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97201_cuf0 ID=transcript:BL97201_cuf0|Name=transcript:BL97201_cuf0|organism=Branchiostoma lanceolatum|type=mRNA|length=1780bp|location=Sequence derived from alignment at Sc0000733:6208..7987+ (Branchiostoma lanceolatum)
GCCGTTATAAAGGCTCCCGCCCCTCAGTTTGTACTCCGACAGCTTCTAAC CGAAAGGTAGAGAGCACCTTATCTGTACTTTCACAGTACGGTGGACGGTT AGAGTAGAGTAACGTTTTTCTGGAATGATGATTAATTTCATGCATGTTGC TTGATTTTCCATTGAGAATGGGATGTGTAAAGCTAGATGGTGCAGTTGGT AGCGTGTTCTGTGTGGGAAAATGACTCGACCAGAGCCGGGAGACCCAGGA CAGGGCTTGGGCAATAACGTTACTAGAAACGATTAGTTTGTTTGAAAGTT TGACATGTTTGGATTCCAGGAAACCATCTTCCTGGAATGGAAACATGTAT TGATGTTTGTTTCTTCTATCTTTTCAGGGCCGTAGCTGTAGCTCGTCGGA CTCATCTTCTGTCTCTCCCGTTCAGCCCAGTCGGCGTGCCACTCCTTCCT TCTGTGTCCGTAGCCAAGAGGAACCAGAGCCAAGATGCCGCCCAAATCCG ACAAGATTTCCGACGACCCTCGGGTCTACATCTACGGTGACACCAAGTTG ATGATGGAGCTCCGCTCCGCACCGTACGATCCCAAGAAGAACGTCTGGGC TCCGGACGACAAAGACGTGTACATCGCTGTGGAGATCAAGGAAGAGAAGG GCGATAAGATCACGGTTCAGTTGCCAAAGGGACAAGTAAGTACATAATCG CTACAAGACCTTTGCGACATCCAGGTCAATGATGCACATCTCTAAGCTGA CGGAATCTAGATTGGTGTATTTGGCCTCTCTCATTGGTCTCTCAGAGAAA ATGACAAAGGTGCACAGCTACTAGAGAAAAACGGCAGACATGGAAGGCTT AAGACTAATAACCAATCTGATCAGCACACAAGCTACCAGGTATTGAAATA CGCGAACTAGACCAATGTTAACTACATGAGCATCTGCCGGGCCAAAGTCA ATGAAAAGGGACAAGATCACATACCAGACATTACTCCTGACCATATCATT TTCATTATTTCTGCTGNGATATCCAAACAATATCACATGAAACCTCATTC CATTTTCTAGTAACAGACTATGATGGTAAACGAGATAAAATTTACAAAGT TTAAAAAAAATGTTCAACCCTTGTTCATCCAACATTACAAGTCAATGAAA GCGAATCAATACCATTTTCTTCCAGGAACAATATTTCTAGGAAAATGTTA AAGATTATTTTCAATTGATTTTGGCTTTACTGGAGGTGATACAAGGCACT GGAATCAACTTGGAATCAACTTGCAATCCTTGAACAGGACCTATTTTCGT TTTCAAACTTTTGTTCAAATCACCAATGTATACACAGTATTTCTTAGATA TCCTAACATCGCTAGCCTANATGAATCGTTGTTGAAACATTGTTCAAACG AAGTTTGATATTTATTGCCACTGCACCATTAACATGTCTTAATATGATGT ATGAAAAAGAACAAAAGGATCCTCAGAACGACGGAAAAAGAAGAAGTTTG TATTTGCAAATTAGCTCTATTTATTTTCCTTAACTTATTTGCCTTTTTTG GTTTTAATCGACACAACGATAAAGTTTTGCAGAAGACTGTACTAATCATA CTAACTACGTTGGGCTCTTCATATGTTCTGTAGACCAAGGAGGTGAAGAA GGACAAGATAGTCATGATGAACCCGCCCAAGTTCGTCTGCTGCGAGGACA TGGCCAACATGACCTACCTGAACGACGCCTCTGTGCTGGCGACCCTCAGG GACCGTTACGCCAACGGCATGATCTACGTA

Coding sequence (CDS) from alignment at Sc0000733:6208..7987+

>transcript:BL97201_cuf0 ID=transcript:BL97201_cuf0|Name=transcript:BL97201_cuf0|organism=Branchiostoma lanceolatum|type=CDS|length=696bp|location=Sequence derived from alignment at Sc0000733:6208..7987+ (Branchiostoma lanceolatum)
ATGCCGCCCAAATCCGACAAGATTTCCGACGACCCTCGGGTCTACATCTA
CGGTGACACCAAGTTGATGATGGAGCTCCGCTCCGCACCGTACGATCCCA
AGAAGAACGTCTGGGCTCCGGACGACAAAGACGTGTACATCGCTGTGGAG
ATCAAGGAAGAGAAGGGCGATAAGATCACGGTTCAGTTGCCAAAGGGACA
AACCAAGGAGGTGAAGAAGGACAAGATAGTCATGATGAACCCGCCCAAGT
TCGTCTGCTGCGAGGACATGGCCAACATGACCTACCTGAACGACGCCTCT
GTGCTGGCGACCCTCAGGGACCGTTACGCCAACGGCATGATCTACGTAAT
GCCGCCCAAATCCGACAAGATTTCCGACGACCCTCGGGTCTACATCTACG
GTGACACCAAGTTGATGATGGAGCTCCGCTCCGCACCGTACGATCCCAAG
AAGAACGTCTGGGCTCCGGACGACAAAGACGTGTACATCGCTGTGGAGAT
CAAGGAAGAGAAGGGCGATAAGATCACGGTTCAGTTGCCAAAGGGACAAA
CCAAGGAGGTGAAGAAGGACAAGATAGTCATGATGAACCCGCCCAAGTTC
GTCTGCTGCGAGGACATGGCCAACATGACCTACCTGAACGACGCCTCTGT
GCTGGCGACCCTCAGGGACCGTTACGCCAACGGCATGATCTACGTA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97201gene:BL97201Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97201_cuf0transcript:BL97201_cuf0-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97201_cuf0-E1BL97201_cuf0-E1-1564476830-496073Branchiostoma lanceolatumexon
BL97201_cuf0-E2BL97201_cuf0-E2-1564476830-496076Branchiostoma lanceolatumexon
BL97201_cuf0-E3BL97201_cuf0-E3-1564476830-496078Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000733genomeSc0000733:6208..7987 +
Properties
Property NameValue
Transcript idBL97201_cuf0
Biotypeprotein_coding