Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97194_cuf1 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97194_cuf1
Unique Nametranscript:BL97194_cuf1
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97194_cuf1

>transcript:BL97194_cuf1-protein ID=transcript:BL97194_cuf1-protein|Name=transcript:BL97194_cuf1|organism=Branchiostoma lanceolatum|type=polypeptide|length=607bp
ENYPGTFICSCDQGFELAEDKVSCQDIDECALQLTNCSQQCENTAGSFNC
ACQDGFTLAANGMDCEPDNPCSAGNDPGCDSEFGWCISNSLGTAECVCRS
GFVLSSDSVTCEDYDECSAGDHHCSQLCNNTASGYSCYCGEGYYTDEEND
HICLDIDECFEGTDNCTDLEVCGNDPGSFHCNCTQDAVLVGDTCVLVTTT
PMMTTKTTTVQTTSPSTTREPSTTATATTTPTTISTTAVAPSTAETTLSL
TTLPRTTTITTTTVAPSTTETTSPQTTKFSTTIDSTTTTTVTTLPPTTTL
SPTTTITTSTVAPPTTKTTTSRTSPESTTLSPTTNSPTTTTISTLPATTT
TTTNEVPSTVETTTSDSFPQSTMSTTLQRTTTSKTTNSPTTTTITTTSAP
STTDTTKSNSSPQTTSTTDSTTLSTTNPPTTTTTQKTVVTSTNPTTAPTS
SPKTTASTTSMLTTTTVQTSPRQTTKTTDATLFPTSIKPEATTSPTTPTT
NAQSTSASPSTTTTSPPQTTQTSSATTSPATITEPMKSTTTTTTPQSEAT
TSYQAPATTSPQPPNTLTEDPSALRPHEQNTLVLTITMTTEEFTAEVKMN
FKHRVAE
Run BLAST on NCBI

mRNA from alignment at Sc0000066:1309201..1313307-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97194_cuf1 ID=transcript:BL97194_cuf1|Name=transcript:BL97194_cuf1|organism=Branchiostoma lanceolatum|type=mRNA|length=4107bp|location=Sequence derived from alignment at Sc0000066:1309201..1313307- (Branchiostoma lanceolatum)
GTGAGAACTACCCCGGAACCTTCATCTGCTCCTGTGACCAGGGGTTCGAG CTCGCAGAGGACAAAGTCTCGTGCCAAGGTTTGAAGCTTAGATATCTTGA CTAAGAATAATGGCGTGGGTTCTTGACGTATTCCAGATAAGATTATCTGT TTAAGATCCTTTTACATTGTAGGGATAACCATGGACAATTTCAAGTTCAC TCCATTGCCAAAGGACTATTGCTGCGGAATGTATCCGTAGACAGGAGAGA GCCTTAGCTTGGATGTAAGGCCAAGAGAATAAAACATCTGAGAAAAAAAG AAACCATTTGACACTTTTCATATAATTGCTTTTTCTCGTTAGATCTGTGG TATAGCGCCATTGTTCACTTGCTCATAATACTGCAGGCAGCACAACTTTT GTGCTAAAAGAATACCTTAGTACGGAGAAGGTTACATACAACAAATAGTT AAATAGATACTTCTTAGTGGCCACCAGTTGAGCTAGATTCATGTGCCCTT TGTAATAAATACGTATTTTTCTTTCTTCCACGCACAGACATAGACGAGTG CGTTCTCTGTCCAATTATAAGCGAGTTACCTCTTCTTATCTAGCCCTGAT GCCAACGTTGGTGCCAGAAAGTTACATAAGTAGAGAGCAAACACAGACTC ATTACATAATTCTTAGCGGCTGTCGGTAGAGCTAGATTTATATAGTCTGT GTTGTAAACCCGTGTTTTTCTGCAACCCACAGACATAGACGAGTGCGCGC TGCAGCTGACCAACTGTAGTCAACAGTGTGAGAACACCGCTGGGTCCTTT AACTGTGCATGTCAGGACGGGTTCACACTGGCAGCTAACGGGATGGACTG TGAACGTGAGTACTACTTGTTCAAGCTTCGTGATCACAGAGTCGTGGAGT AATGTAAACTCTATATCGTATGAACGACGAATCTTTACTGAACACATTTG CATTCTACTGTTCACAGCTGACAATCCGTGCAGTGCGGGAAACGATCCTG GATGTGACTCAGAGTTCGGCTGGTGCATCTCTAACAGCCTCGGTACTGCA GAGTGTGTCTGTAGGTCCGGGTTTGTGCTGTCGTCGGACAGTGTGACTTG CGAAGGTAGGTTGTAGTTGTAGTTACTCATGATTGAAGGACTAGTATGTA TCTGTTGTTGCGTCCATTACAGAAAGAGTGTTGAAATGCTACAACAGGGA CAAAGAGACAACAAGAATTATTGTGTGCGTATTTTGATCCAAGAACTAGG TTAAAGTCACAGTCATAAACATAAGTATAAGGATAGAAATCAATCTCGAT GTCGCTAAAGTACTCGAGCGATCATTCAATGATGGGTTTTGTCTTTCTGC AGACTATGACGAGTGTTCAGCCGGTGATCACCACTGCTCTCAGCTGTGCA ACAACACGGCCAGTGGGTACAGCTGCTACTGTGGGGAGGGCTACTACACT GACGAGGAGAATGACCATATATGCCTGGGTAAGGTCAAGACCCCAACTAT TATCCCAAACGAATGTAAAGAAGAAGCTTTATTAACACAATATAAACTAC AGTAAAGTAGGATCAACTGCAAACTACAAAATAGATTTGCATGTAGCATG CATTTTACACATAATTATATATTAATTGAAAAAATGCAGAAATGTGATCT ACATTAAACAGCATCGCCAGTAATGATCAAACAAAAAACAACCACCGATA TGACCAAAAATAACACTCAGTCGTTCAAATATGTTTCCCAACAGACATCG ATGAGTGTTTCGAGGGGACCGACAACTGCACAGACCTTGAGGTGTGTGGG AATGACCCAGGCTCCTTCCACTGCAACTGTACACAAGACGCTGTGCTGGT GGGAGACACCTGTGTACTAGGTAAGTTTCCCATAGCTAAAACCTTTATCA TAGTCAGTTATCAAAGCTTTTTACCTTGTGTATTTGTATTACATAAAGGT AAGTAAATGAAGACATCATTGTTAAATTGCTAACCCTGCAACACCGATAT TTAGAAGTTGACATCTATTTTTAAAAACTGCGTTTCTGGCTGATCTAAGC CACAACATACCGGCACATACTATGAAAGATGGGTGTTCTTTAATAAAATG CTCGAGAGTCATTGCACATGAGGCCAGTGACTCAGCAGGTCTATAGCAGT GCTCCAATTAGTATCAAGGACATTGTAGCAAAGATTCTTTGGCCGGTAAA TAATGATTCTCTACAGACCAAACGGCCTGTCTGTCCAAATTGAAATGCGG TTTTGATATATGAATCTTGTCGTCCACCTTCAGTGACTACCACACCAATG ATGACTACAAAGACAACAACAGTACAGACCACCAGTCCCAGTACAACCAG GGAACCCAGTACTACAGCAACGGCCACTACTACTCCAACCACAATCAGTA CTACTGCTGTAGCTCCATCTACAGCTGAAACCACTCTTTCTCTAACTACT CTGCCTCGAACCACCACCATCACTACCACTACTGTAGCGCCATCCACTAC TGAAACCACTTCCCCTCAAACTACAAAATTCTCCACTACCATCGATTCTA CAACCACTACCACAGTCACCACTCTTCCTCCAACTACCACTCTGTCTCCA ACCACTACCATCACTACTTCCACTGTAGCTCCCCCCACCACTAAAACCAC TACATCAAGGACTTCCCCGGAAAGTACCACACTTTCCCCGACCACTAATT CCCCAACTACTACCACAATCAGCACTCTTCCTGCAACTACTACCACTACT ACTAACGAAGTCCCCTCTACTGTTGAAACCACTACTTCAGATTCTTTCCC TCAAAGTACCATGAGTACTACTCTACAGCGGACTACTACCTCTAAAACTA CTAACTCCCCAACCACCACCACCATAACTACGACTTCAGCCCCTTCAACT ACTGATACCACTAAATCCAACTCGTCTCCTCAAACCACTAGTACTACAGA TTCCACAACCTTAAGCACAACTAACCCTCCAACAACCACCACCACTCAGA AAACTGTAGTTACTTCCACTAATCCAACCACTGCGCCTACGTCTTCCCCC AAAACCACGGCAAGCACAACTTCCATGCTTACAACAACCACTGTGCAAAC TTCTCCCCGTCAAACTACCAAAACCACCGATGCAACACTTTTCCCAACCT CTATTAAACCTGAAGCCACCACCTCTCCTACTACCCCTACAACTAACGCT CAGTCGACTTCTGCATCTCCAAGCACTACAACAACCTCTCCCCCTCAAAC CACCCAAACCAGCTCGGCCACTACGTCCCCAGCCACTATCACAGAGCCTA TGAAATCGACTACAACAACTACCACTCCTCAATCTGAAGCTACTACTAGT TACCAAGCGCCTGCTACCACTTCCCCCCAACCTCCGAATACGCTGACAGA GGATCCTTCAGCTTTGAGGCCGCATGAACAAAACACCTTGGTTCTGACAA TAACCATGACAACAGAAGAGGTAAAATCTTTTTTCAGAGTTGTAAGATAT AAGTACACCGTACCTTAAGCACCCCTCTCACTGTACCCGCGGCACGCTGG CGGCGTCGCTGCGGCCGATCGAATCGACAAAGCACTCAACGAATTTCATC GACAAAAAAAACGAATTTTTTTTTCAAGCTTTATGTGTTTTGTTGTCTTT TGGGTCATACTTGTACGTTTTGAATGATATTCCCATTATGAAGTCAATGG TAACACAAATCCAGTTTAAGACGCAGCCAGCGTGCCGCGGGTCCAGTGAG AGGGGACTTAACCATAACCCCAACCATGCACTGATCCTTGAAAGATTCCA TTATAAGGATATCAAATTTTTTTTTCTTTGCAAGACAAAGTAAAGATAAC ACATGTTTAATACATACCCAGTCGAAATTTGCTCAATGTATCTCAAGAAA AGGTGAAACACCTTATAAAAATATTGATGTTTAATGGTAGGCTTTATATA TTCACTATATTATGCTCTTTCGTGATCATCTAAAAGAAACTATGATCTTA TACAAGCAATTCCGGGCCACCTCTCCCAATACTAAACGTACCTCTTATCC TCTTCTGATAGTTCACTGCTGAGGTCAAGATGAACTTCAAGCACAGGGTT GCTGAGA

Coding sequence (CDS) from alignment at Sc0000066:1309201..1313307-

>transcript:BL97194_cuf1 ID=transcript:BL97194_cuf1|Name=transcript:BL97194_cuf1|organism=Branchiostoma lanceolatum|type=CDS|length=12747bp|location=Sequence derived from alignment at Sc0000066:1309201..1313307- (Branchiostoma lanceolatum)
GAGAACTACCCCGGAACCTTCATCTGCTCCTGTGACCAGGGGTTCGAGCT
CGCAGAGGACAAAGTCTCGTGCCAAGACATAGACGAGTGCGCGCTGCAGC
TGACCAACTGTAGTCAACAGTGTGAGAACACCGCTGGGTCCTTTAACTGT
GCATGTCAGGACGGGTTCACACTGGCAGCTAACGGGATGGACTGTGAACC
TGACAATCCGTGCAGTGCGGGAAACGATCCTGGATGTGACTCAGAGTTCG
GCTGGTGCATCTCTAACAGCCTCGGTACTGCAGAGTGTGTCTGTAGGTCC
GGGTTTGTGCTGTCGTCGGACAGTGTGACTTGCGAAGACTATGACGAGTG
TTCAGCCGGTGATCACCACTGCTCTCAGCTGTGCAACAACACGGCCAGTG
GGTACAGCTGCTACTGTGGGGAGGGCTACTACACTGACGAGGAGAATGAC
CATATATGCCTGGACATCGATGAGTGTTTCGAGGGGACCGACAACTGCAC
AGACCTTGAGGTGTGTGGGAATGACCCAGGCTCCTTCCACTGCAACTGTA
CACAAGACGCTGTGCTGGTGGGAGACACCTGTGTACTAGTGACTACCACA
CCAATGATGACTACAAAGACAACAACAGTACAGACCACCAGTCCCAGTAC
AACCAGGGAACCCAGTACTACAGCAACGGCCACTACTACTCCAACCACAA
TCAGTACTACTGCTGTAGCTCCATCTACAGCTGAAACCACTCTTTCTCTA
ACTACTCTGCCTCGAACCACCACCATCACTACCACTACTGTAGCGCCATC
CACTACTGAAACCACTTCCCCTCAAACTACAAAATTCTCCACTACCATCG
ATTCTACAACCACTACCACAGTCACCACTCTTCCTCCAACTACCACTCTG
TCTCCAACCACTACCATCACTACTTCCACTGTAGCTCCCCCCACCACTAA
AACCACTACATCAAGGACTTCCCCGGAAAGTACCACACTTTCCCCGACCA
CTAATTCCCCAACTACTACCACAATCAGCACTCTTCCTGCAACTACTACC
ACTACTACTAACGAAGTCCCCTCTACTGTTGAAACCACTACTTCAGATTC
TTTCCCTCAAAGTACCATGAGTACTACTCTACAGCGGACTACTACCTCTA
AAACTACTAACTCCCCAACCACCACCACCATAACTACGACTTCAGCCCCT
TCAACTACTGATACCACTAAATCCAACTCGTCTCCTCAAACCACTAGTAC
TACAGATTCCACAACCTTAAGCACAACTAACCCTCCAACAACCACCACCA
CTCAGAAAACTGTAGTTACTTCCACTAATCCAACCACTGCGCCTACGTCT
TCCCCCAAAACCACGGCAAGCACAACTTCCATGCTTACAACAACCACTGT
GCAAACTTCTCCCCGTCAAACTACCAAAACCACCGATGCAACACTTTTCC
CAACCTCTATTAAACCTGAAGCCACCACCTCTCCTACTACCCCTACAACT
AACGCTCAGTCGACTTCTGCATCTCCAAGCACTACAACAACCTCTCCCCC
TCAAACCACCCAAACCAGCTCGGCCACTACGTCCCCAGCCACTATCACAG
AGCCTATGAAATCGACTACAACAACTACCACTCCTCAATCTGAAGCTACT
ACTAGTTACCAAGCGCCTGCTACCACTTCCCCCCAACCTCCGAATACGCT
GACAGAGGATCCTTCAGCTTTGAGGCCGCATGAACAAAACACCTTGGTTC
TGACAATAACCATGACAACAGAAGAGTTCACTGCTGAGGTCAAGATGAAC
TTCAAGCACAGGGTTGCTGAGGAGAACTACCCCGGAACCTTCATCTGCTC
CTGTGACCAGGGGTTCGAGCTCGCAGAGGACAAAGTCTCGTGCCAAGACA
TAGACGAGTGCGCGCTGCAGCTGACCAACTGTAGTCAACAGTGTGAGAAC
ACCGCTGGGTCCTTTAACTGTGCATGTCAGGACGGGTTCACACTGGCAGC
TAACGGGATGGACTGTGAACCTGACAATCCGTGCAGTGCGGGAAACGATC
CTGGATGTGACTCAGAGTTCGGCTGGTGCATCTCTAACAGCCTCGGTACT
GCAGAGTGTGTCTGTAGGTCCGGGTTTGTGCTGTCGTCGGACAGTGTGAC
TTGCGAAGACTATGACGAGTGTTCAGCCGGTGATCACCACTGCTCTCAGC
TGTGCAACAACACGGCCAGTGGGTACAGCTGCTACTGTGGGGAGGGCTAC
TACACTGACGAGGAGAATGACCATATATGCCTGGACATCGATGAGTGTTT
CGAGGGGACCGACAACTGCACAGACCTTGAGGTGTGTGGGAATGACCCAG
GCTCCTTCCACTGCAACTGTACACAAGACGCTGTGCTGGTGGGAGACACC
TGTGTACTAGTGACTACCACACCAATGATGACTACAAAGACAACAACAGT
ACAGACCACCAGTCCCAGTACAACCAGGGAACCCAGTACTACAGCAACGG
CCACTACTACTCCAACCACAATCAGTACTACTGCTGTAGCTCCATCTACA
GCTGAAACCACTCTTTCTCTAACTACTCTGCCTCGAACCACCACCATCAC
TACCACTACTGTAGCGCCATCCACTACTGAAACCACTTCCCCTCAAACTA
CAAAATTCTCCACTACCATCGATTCTACAACCACTACCACAGTCACCACT
CTTCCTCCAACTACCACTCTGTCTCCAACCACTACCATCACTACTTCCAC
TGTAGCTCCCCCCACCACTAAAACCACTACATCAAGGACTTCCCCGGAAA
GTACCACACTTTCCCCGACCACTAATTCCCCAACTACTACCACAATCAGC
ACTCTTCCTGCAACTACTACCACTACTACTAACGAAGTCCCCTCTACTGT
TGAAACCACTACTTCAGATTCTTTCCCTCAAAGTACCATGAGTACTACTC
TACAGCGGACTACTACCTCTAAAACTACTAACTCCCCAACCACCACCACC
ATAACTACGACTTCAGCCCCTTCAACTACTGATACCACTAAATCCAACTC
GTCTCCTCAAACCACTAGTACTACAGATTCCACAACCTTAAGCACAACTA
ACCCTCCAACAACCACCACCACTCAGAAAACTGTAGTTACTTCCACTAAT
CCAACCACTGCGCCTACGTCTTCCCCCAAAACCACGGCAAGCACAACTTC
CATGCTTACAACAACCACTGTGCAAACTTCTCCCCGTCAAACTACCAAAA
CCACCGATGCAACACTTTTCCCAACCTCTATTAAACCTGAAGCCACCACC
TCTCCTACTACCCCTACAACTAACGCTCAGTCGACTTCTGCATCTCCAAG
CACTACAACAACCTCTCCCCCTCAAACCACCCAAACCAGCTCGGCCACTA
CGTCCCCAGCCACTATCACAGAGCCTATGAAATCGACTACAACAACTACC
ACTCCTCAATCTGAAGCTACTACTAGTTACCAAGCGCCTGCTACCACTTC
CCCCCAACCTCCGAATACGCTGACAGAGGATCCTTCAGCTTTGAGGCCGC
ATGAACAAAACACCTTGGTTCTGACAATAACCATGACAACAGAAGAGTTC
ACTGCTGAGGTCAAGATGAACTTCAAGCACAGGGTTGCTGAGGAGAACTA
CCCCGGAACCTTCATCTGCTCCTGTGACCAGGGGTTCGAGCTCGCAGAGG
ACAAAGTCTCGTGCCAAGACATAGACGAGTGCGCGCTGCAGCTGACCAAC
TGTAGTCAACAGTGTGAGAACACCGCTGGGTCCTTTAACTGTGCATGTCA
GGACGGGTTCACACTGGCAGCTAACGGGATGGACTGTGAACCTGACAATC
CGTGCAGTGCGGGAAACGATCCTGGATGTGACTCAGAGTTCGGCTGGTGC
ATCTCTAACAGCCTCGGTACTGCAGAGTGTGTCTGTAGGTCCGGGTTTGT
GCTGTCGTCGGACAGTGTGACTTGCGAAGACTATGACGAGTGTTCAGCCG
GTGATCACCACTGCTCTCAGCTGTGCAACAACACGGCCAGTGGGTACAGC
TGCTACTGTGGGGAGGGCTACTACACTGACGAGGAGAATGACCATATATG
CCTGGACATCGATGAGTGTTTCGAGGGGACCGACAACTGCACAGACCTTG
AGGTGTGTGGGAATGACCCAGGCTCCTTCCACTGCAACTGTACACAAGAC
GCTGTGCTGGTGGGAGACACCTGTGTACTAGTGACTACCACACCAATGAT
GACTACAAAGACAACAACAGTACAGACCACCAGTCCCAGTACAACCAGGG
AACCCAGTACTACAGCAACGGCCACTACTACTCCAACCACAATCAGTACT
ACTGCTGTAGCTCCATCTACAGCTGAAACCACTCTTTCTCTAACTACTCT
GCCTCGAACCACCACCATCACTACCACTACTGTAGCGCCATCCACTACTG
AAACCACTTCCCCTCAAACTACAAAATTCTCCACTACCATCGATTCTACA
ACCACTACCACAGTCACCACTCTTCCTCCAACTACCACTCTGTCTCCAAC
CACTACCATCACTACTTCCACTGTAGCTCCCCCCACCACTAAAACCACTA
CATCAAGGACTTCCCCGGAAAGTACCACACTTTCCCCGACCACTAATTCC
CCAACTACTACCACAATCAGCACTCTTCCTGCAACTACTACCACTACTAC
TAACGAAGTCCCCTCTACTGTTGAAACCACTACTTCAGATTCTTTCCCTC
AAAGTACCATGAGTACTACTCTACAGCGGACTACTACCTCTAAAACTACT
AACTCCCCAACCACCACCACCATAACTACGACTTCAGCCCCTTCAACTAC
TGATACCACTAAATCCAACTCGTCTCCTCAAACCACTAGTACTACAGATT
CCACAACCTTAAGCACAACTAACCCTCCAACAACCACCACCACTCAGAAA
ACTGTAGTTACTTCCACTAATCCAACCACTGCGCCTACGTCTTCCCCCAA
AACCACGGCAAGCACAACTTCCATGCTTACAACAACCACTGTGCAAACTT
CTCCCCGTCAAACTACCAAAACCACCGATGCAACACTTTTCCCAACCTCT
ATTAAACCTGAAGCCACCACCTCTCCTACTACCCCTACAACTAACGCTCA
GTCGACTTCTGCATCTCCAAGCACTACAACAACCTCTCCCCCTCAAACCA
CCCAAACCAGCTCGGCCACTACGTCCCCAGCCACTATCACAGAGCCTATG
AAATCGACTACAACAACTACCACTCCTCAATCTGAAGCTACTACTAGTTA
CCAAGCGCCTGCTACCACTTCCCCCCAACCTCCGAATACGCTGACAGAGG
ATCCTTCAGCTTTGAGGCCGCATGAACAAAACACCTTGGTTCTGACAATA
ACCATGACAACAGAAGAGTTCACTGCTGAGGTCAAGATGAACTTCAAGCA
CAGGGTTGCTGAGGAGAACTACCCCGGAACCTTCATCTGCTCCTGTGACC
AGGGGTTCGAGCTCGCAGAGGACAAAGTCTCGTGCCAAGACATAGACGAG
TGCGCGCTGCAGCTGACCAACTGTAGTCAACAGTGTGAGAACACCGCTGG
GTCCTTTAACTGTGCATGTCAGGACGGGTTCACACTGGCAGCTAACGGGA
TGGACTGTGAACCTGACAATCCGTGCAGTGCGGGAAACGATCCTGGATGT
GACTCAGAGTTCGGCTGGTGCATCTCTAACAGCCTCGGTACTGCAGAGTG
TGTCTGTAGGTCCGGGTTTGTGCTGTCGTCGGACAGTGTGACTTGCGAAG
ACTATGACGAGTGTTCAGCCGGTGATCACCACTGCTCTCAGCTGTGCAAC
AACACGGCCAGTGGGTACAGCTGCTACTGTGGGGAGGGCTACTACACTGA
CGAGGAGAATGACCATATATGCCTGGACATCGATGAGTGTTTCGAGGGGA
CCGACAACTGCACAGACCTTGAGGTGTGTGGGAATGACCCAGGCTCCTTC
CACTGCAACTGTACACAAGACGCTGTGCTGGTGGGAGACACCTGTGTACT
AGTGACTACCACACCAATGATGACTACAAAGACAACAACAGTACAGACCA
CCAGTCCCAGTACAACCAGGGAACCCAGTACTACAGCAACGGCCACTACT
ACTCCAACCACAATCAGTACTACTGCTGTAGCTCCATCTACAGCTGAAAC
CACTCTTTCTCTAACTACTCTGCCTCGAACCACCACCATCACTACCACTA
CTGTAGCGCCATCCACTACTGAAACCACTTCCCCTCAAACTACAAAATTC
TCCACTACCATCGATTCTACAACCACTACCACAGTCACCACTCTTCCTCC
AACTACCACTCTGTCTCCAACCACTACCATCACTACTTCCACTGTAGCTC
CCCCCACCACTAAAACCACTACATCAAGGACTTCCCCGGAAAGTACCACA
CTTTCCCCGACCACTAATTCCCCAACTACTACCACAATCAGCACTCTTCC
TGCAACTACTACCACTACTACTAACGAAGTCCCCTCTACTGTTGAAACCA
CTACTTCAGATTCTTTCCCTCAAAGTACCATGAGTACTACTCTACAGCGG
ACTACTACCTCTAAAACTACTAACTCCCCAACCACCACCACCATAACTAC
GACTTCAGCCCCTTCAACTACTGATACCACTAAATCCAACTCGTCTCCTC
AAACCACTAGTACTACAGATTCCACAACCTTAAGCACAACTAACCCTCCA
ACAACCACCACCACTCAGAAAACTGTAGTTACTTCCACTAATCCAACCAC
TGCGCCTACGTCTTCCCCCAAAACCACGGCAAGCACAACTTCCATGCTTA
CAACAACCACTGTGCAAACTTCTCCCCGTCAAACTACCAAAACCACCGAT
GCAACACTTTTCCCAACCTCTATTAAACCTGAAGCCACCACCTCTCCTAC
TACCCCTACAACTAACGCTCAGTCGACTTCTGCATCTCCAAGCACTACAA
CAACCTCTCCCCCTCAAACCACCCAAACCAGCTCGGCCACTACGTCCCCA
GCCACTATCACAGAGCCTATGAAATCGACTACAACAACTACCACTCCTCA
ATCTGAAGCTACTACTAGTTACCAAGCGCCTGCTACCACTTCCCCCCAAC
CTCCGAATACGCTGACAGAGGATCCTTCAGCTTTGAGGCCGCATGAACAA
AACACCTTGGTTCTGACAATAACCATGACAACAGAAGAGTTCACTGCTGA
GGTCAAGATGAACTTCAAGCACAGGGTTGCTGAGGAGAACTACCCCGGAA
CCTTCATCTGCTCCTGTGACCAGGGGTTCGAGCTCGCAGAGGACAAAGTC
TCGTGCCAAGACATAGACGAGTGCGCGCTGCAGCTGACCAACTGTAGTCA
ACAGTGTGAGAACACCGCTGGGTCCTTTAACTGTGCATGTCAGGACGGGT
TCACACTGGCAGCTAACGGGATGGACTGTGAACCTGACAATCCGTGCAGT
GCGGGAAACGATCCTGGATGTGACTCAGAGTTCGGCTGGTGCATCTCTAA
CAGCCTCGGTACTGCAGAGTGTGTCTGTAGGTCCGGGTTTGTGCTGTCGT
CGGACAGTGTGACTTGCGAAGACTATGACGAGTGTTCAGCCGGTGATCAC
CACTGCTCTCAGCTGTGCAACAACACGGCCAGTGGGTACAGCTGCTACTG
TGGGGAGGGCTACTACACTGACGAGGAGAATGACCATATATGCCTGGACA
TCGATGAGTGTTTCGAGGGGACCGACAACTGCACAGACCTTGAGGTGTGT
GGGAATGACCCAGGCTCCTTCCACTGCAACTGTACACAAGACGCTGTGCT
GGTGGGAGACACCTGTGTACTAGTGACTACCACACCAATGATGACTACAA
AGACAACAACAGTACAGACCACCAGTCCCAGTACAACCAGGGAACCCAGT
ACTACAGCAACGGCCACTACTACTCCAACCACAATCAGTACTACTGCTGT
AGCTCCATCTACAGCTGAAACCACTCTTTCTCTAACTACTCTGCCTCGAA
CCACCACCATCACTACCACTACTGTAGCGCCATCCACTACTGAAACCACT
TCCCCTCAAACTACAAAATTCTCCACTACCATCGATTCTACAACCACTAC
CACAGTCACCACTCTTCCTCCAACTACCACTCTGTCTCCAACCACTACCA
TCACTACTTCCACTGTAGCTCCCCCCACCACTAAAACCACTACATCAAGG
ACTTCCCCGGAAAGTACCACACTTTCCCCGACCACTAATTCCCCAACTAC
TACCACAATCAGCACTCTTCCTGCAACTACTACCACTACTACTAACGAAG
TCCCCTCTACTGTTGAAACCACTACTTCAGATTCTTTCCCTCAAAGTACC
ATGAGTACTACTCTACAGCGGACTACTACCTCTAAAACTACTAACTCCCC
AACCACCACCACCATAACTACGACTTCAGCCCCTTCAACTACTGATACCA
CTAAATCCAACTCGTCTCCTCAAACCACTAGTACTACAGATTCCACAACC
TTAAGCACAACTAACCCTCCAACAACCACCACCACTCAGAAAACTGTAGT
TACTTCCACTAATCCAACCACTGCGCCTACGTCTTCCCCCAAAACCACGG
CAAGCACAACTTCCATGCTTACAACAACCACTGTGCAAACTTCTCCCCGT
CAAACTACCAAAACCACCGATGCAACACTTTTCCCAACCTCTATTAAACC
TGAAGCCACCACCTCTCCTACTACCCCTACAACTAACGCTCAGTCGACTT
CTGCATCTCCAAGCACTACAACAACCTCTCCCCCTCAAACCACCCAAACC
AGCTCGGCCACTACGTCCCCAGCCACTATCACAGAGCCTATGAAATCGAC
TACAACAACTACCACTCCTCAATCTGAAGCTACTACTAGTTACCAAGCGC
CTGCTACCACTTCCCCCCAACCTCCGAATACGCTGACAGAGGATCCTTCA
GCTTTGAGGCCGCATGAACAAAACACCTTGGTTCTGACAATAACCATGAC
AACAGAAGAGTTCACTGCTGAGGTCAAGATGAACTTCAAGCACAGGGTTG
CTGAGGAGAACTACCCCGGAACCTTCATCTGCTCCTGTGACCAGGGGTTC
GAGCTCGCAGAGGACAAAGTCTCGTGCCAAGACATAGACGAGTGCGCGCT
GCAGCTGACCAACTGTAGTCAACAGTGTGAGAACACCGCTGGGTCCTTTA
ACTGTGCATGTCAGGACGGGTTCACACTGGCAGCTAACGGGATGGACTGT
GAACCTGACAATCCGTGCAGTGCGGGAAACGATCCTGGATGTGACTCAGA
GTTCGGCTGGTGCATCTCTAACAGCCTCGGTACTGCAGAGTGTGTCTGTA
GGTCCGGGTTTGTGCTGTCGTCGGACAGTGTGACTTGCGAAGACTATGAC
GAGTGTTCAGCCGGTGATCACCACTGCTCTCAGCTGTGCAACAACACGGC
CAGTGGGTACAGCTGCTACTGTGGGGAGGGCTACTACACTGACGAGGAGA
ATGACCATATATGCCTGGACATCGATGAGTGTTTCGAGGGGACCGACAAC
TGCACAGACCTTGAGGTGTGTGGGAATGACCCAGGCTCCTTCCACTGCAA
CTGTACACAAGACGCTGTGCTGGTGGGAGACACCTGTGTACTAGTGACTA
CCACACCAATGATGACTACAAAGACAACAACAGTACAGACCACCAGTCCC
AGTACAACCAGGGAACCCAGTACTACAGCAACGGCCACTACTACTCCAAC
CACAATCAGTACTACTGCTGTAGCTCCATCTACAGCTGAAACCACTCTTT
CTCTAACTACTCTGCCTCGAACCACCACCATCACTACCACTACTGTAGCG
CCATCCACTACTGAAACCACTTCCCCTCAAACTACAAAATTCTCCACTAC
CATCGATTCTACAACCACTACCACAGTCACCACTCTTCCTCCAACTACCA
CTCTGTCTCCAACCACTACCATCACTACTTCCACTGTAGCTCCCCCCACC
ACTAAAACCACTACATCAAGGACTTCCCCGGAAAGTACCACACTTTCCCC
GACCACTAATTCCCCAACTACTACCACAATCAGCACTCTTCCTGCAACTA
CTACCACTACTACTAACGAAGTCCCCTCTACTGTTGAAACCACTACTTCA
GATTCTTTCCCTCAAAGTACCATGAGTACTACTCTACAGCGGACTACTAC
CTCTAAAACTACTAACTCCCCAACCACCACCACCATAACTACGACTTCAG
CCCCTTCAACTACTGATACCACTAAATCCAACTCGTCTCCTCAAACCACT
AGTACTACAGATTCCACAACCTTAAGCACAACTAACCCTCCAACAACCAC
CACCACTCAGAAAACTGTAGTTACTTCCACTAATCCAACCACTGCGCCTA
CGTCTTCCCCCAAAACCACGGCAAGCACAACTTCCATGCTTACAACAACC
ACTGTGCAAACTTCTCCCCGTCAAACTACCAAAACCACCGATGCAACACT
TTTCCCAACCTCTATTAAACCTGAAGCCACCACCTCTCCTACTACCCCTA
CAACTAACGCTCAGTCGACTTCTGCATCTCCAAGCACTACAACAACCTCT
CCCCCTCAAACCACCCAAACCAGCTCGGCCACTACGTCCCCAGCCACTAT
CACAGAGCCTATGAAATCGACTACAACAACTACCACTCCTCAATCTGAAG
CTACTACTAGTTACCAAGCGCCTGCTACCACTTCCCCCCAACCTCCGAAT
ACGCTGACAGAGGATCCTTCAGCTTTGAGGCCGCATGAACAAAACACCTT
GGTTCTGACAATAACCATGACAACAGAAGAGTTCACTGCTGAGGTCAAGA
TGAACTTCAAGCACAGGGTTGCTGAGGAGAACTACCCCGGAACCTTCATC
TGCTCCTGTGACCAGGGGTTCGAGCTCGCAGAGGACAAAGTCTCGTGCCA
AGACATAGACGAGTGCGCGCTGCAGCTGACCAACTGTAGTCAACAGTGTG
AGAACACCGCTGGGTCCTTTAACTGTGCATGTCAGGACGGGTTCACACTG
GCAGCTAACGGGATGGACTGTGAACCTGACAATCCGTGCAGTGCGGGAAA
CGATCCTGGATGTGACTCAGAGTTCGGCTGGTGCATCTCTAACAGCCTCG
GTACTGCAGAGTGTGTCTGTAGGTCCGGGTTTGTGCTGTCGTCGGACAGT
GTGACTTGCGAAGACTATGACGAGTGTTCAGCCGGTGATCACCACTGCTC
TCAGCTGTGCAACAACACGGCCAGTGGGTACAGCTGCTACTGTGGGGAGG
GCTACTACACTGACGAGGAGAATGACCATATATGCCTGGACATCGATGAG
TGTTTCGAGGGGACCGACAACTGCACAGACCTTGAGGTGTGTGGGAATGA
CCCAGGCTCCTTCCACTGCAACTGTACACAAGACGCTGTGCTGGTGGGAG
ACACCTGTGTACTAGTGACTACCACACCAATGATGACTACAAAGACAACA
ACAGTACAGACCACCAGTCCCAGTACAACCAGGGAACCCAGTACTACAGC
AACGGCCACTACTACTCCAACCACAATCAGTACTACTGCTGTAGCTCCAT
CTACAGCTGAAACCACTCTTTCTCTAACTACTCTGCCTCGAACCACCACC
ATCACTACCACTACTGTAGCGCCATCCACTACTGAAACCACTTCCCCTCA
AACTACAAAATTCTCCACTACCATCGATTCTACAACCACTACCACAGTCA
CCACTCTTCCTCCAACTACCACTCTGTCTCCAACCACTACCATCACTACT
TCCACTGTAGCTCCCCCCACCACTAAAACCACTACATCAAGGACTTCCCC
GGAAAGTACCACACTTTCCCCGACCACTAATTCCCCAACTACTACCACAA
TCAGCACTCTTCCTGCAACTACTACCACTACTACTAACGAAGTCCCCTCT
ACTGTTGAAACCACTACTTCAGATTCTTTCCCTCAAAGTACCATGAGTAC
TACTCTACAGCGGACTACTACCTCTAAAACTACTAACTCCCCAACCACCA
CCACCATAACTACGACTTCAGCCCCTTCAACTACTGATACCACTAAATCC
AACTCGTCTCCTCAAACCACTAGTACTACAGATTCCACAACCTTAAGCAC
AACTAACCCTCCAACAACCACCACCACTCAGAAAACTGTAGTTACTTCCA
CTAATCCAACCACTGCGCCTACGTCTTCCCCCAAAACCACGGCAAGCACA
ACTTCCATGCTTACAACAACCACTGTGCAAACTTCTCCCCGTCAAACTAC
CAAAACCACCGATGCAACACTTTTCCCAACCTCTATTAAACCTGAAGCCA
CCACCTCTCCTACTACCCCTACAACTAACGCTCAGTCGACTTCTGCATCT
CCAAGCACTACAACAACCTCTCCCCCTCAAACCACCCAAACCAGCTCGGC
CACTACGTCCCCAGCCACTATCACAGAGCCTATGAAATCGACTACAACAA
CTACCACTCCTCAATCTGAAGCTACTACTAGTTACCAAGCGCCTGCTACC
ACTTCCCCCCAACCTCCGAATACGCTGACAGAGGATCCTTCAGCTTTGAG
GCCGCATGAACAAAACACCTTGGTTCTGACAATAACCATGACAACAGAAG
AGTTCACTGCTGAGGTCAAGATGAACTTCAAGCACAGGGTTGCTGAG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97194gene:BL97194Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97194_cuf1transcript:BL97194_cuf1-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97194_cuf1-E1BL97194_cuf1-E1-1564476830-256906Branchiostoma lanceolatumexon
BL97194_cuf1-E2BL97194_cuf1-E2-1564476830-256903Branchiostoma lanceolatumexon
BL97194_cuf1-E3BL97194_cuf1-E3-1564476830-256901Branchiostoma lanceolatumexon
BL97194_cuf1-E4BL97194_cuf1-E4-1564476830-256899Branchiostoma lanceolatumexon
BL97194_cuf1-E5BL97194_cuf1-E5-1564476830-256897Branchiostoma lanceolatumexon
BL97194_cuf1-E6BL97194_cuf1-E6-1564476830-256895Branchiostoma lanceolatumexon
BL97194_cuf1-E7BL97194_cuf1-E7-1564476830-256893Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000066genomeSc0000066:1309201..1313307 -
Properties
Property NameValue
Transcript idBL97194_cuf1
Biotypeprotein_coding