Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97098_cuf9 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97098_cuf9
Unique Nametranscript:BL97098_cuf9
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97098_cuf9

>transcript:BL97098_cuf9-protein ID=transcript:BL97098_cuf9-protein|Name=transcript:BL97098_cuf9|organism=Branchiostoma lanceolatum|type=polypeptide|length=107bp
MWGVGTSVGADDIVPFHELPHTQHAACTELNRTLQHGGTYYSTLVAFNLG
HAMKNVSVSSDGVLYDATPPEEGWVKDGLDPDNDVTYSSETASVSALWGD
FRDPESD
Run BLAST on NCBI

mRNA from alignment at Sc0000001:3634195..3638545+

Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97098_cuf9 ID=transcript:BL97098_cuf9|Name=transcript:BL97098_cuf9|organism=Branchiostoma lanceolatum|type=mRNA|length=4351bp|location=Sequence derived from alignment at Sc0000001:3634195..3638545+ (Branchiostoma lanceolatum)
CTAGCTGTACTACTATAACCTGTTCCTCAACAACACTGTTGGTAAGTTGT AAATAAACCTTATGTAACTATCAGGTTTCTTATCATTGAAATAGTTCATG ACTAACGTTGCTTTGATATCAAGAAAACTGTGTTGGACCTCTGGTAAAAC ATGCCACTAAATATGCAATTACGTTGAATTATGATCAAAATGTACATGTT CAGCTTCTAAAATAGACTGCAACTGTGTAAGAGGTAAAGTTCTTTTGGAC TGCCAAATGTTAGATATTCTACATGTATGTCGGGCCTAATTTCTCTGTGT AATGATGTTAGTTTTCATTCACCTTGTGACCACAGGAAGAGTAGCTTAAT CTTGCAATTAGCTATTATGGATCTAAATGAAATCAAACTTAAACGCTTTC TTGCTACAATAATCAGGCTACACGAACATCCTGACGTCTCCGGCCGTGAT AGTTGACTTCGTCCCCCCGTCCCCCGGACCGCTGGCGAACGTGAGTCTGG ACGAGACGAACGCGGAGGTGTGTGAGGAGTTTGTACCGGACGAGTGGGAG GACAGATGTGTGGAGCAGACACCTCTTCCAAACCATAGGTGCGACGTCGT GCTTTCCAGACATGAGTCGACGCTGTTTGATCCCAGTCTTTCACGCCATT TGCCCCTTTACTATTAACGTGTTGTTTTCGTTTCACCAAAGCAAACTATT CTGCCAAATCGGACTGAAGTTCAGGAAAATGATGTAAGTTTTAGAACGTT CTTTGTATTTGTCGATATACATGTAATAAGCTCAGCGTCATTTGTTGAGT CTTTATGTGATCCACACAGGGCCATTATAGACGGAGAGGGGTCCGGAACT GTGTTTAACGGTAACAAGCCTCTGGAAGACCTGCGCTATTTCCGACCTAA CACTTACGTCACGGGTACGTATCATTCGATGTTATCATCATATAGATAGC CTTATAAATGTTATCATCAGTACCGAGTTTAAAATCTTCTACATGTAGTG CGATTATAACAAAATAAGTATTTGCTCTTTATCCAAGGATTTCTAACTTC TTGTTGATAAAGTCGTCATTTTTTTCATATATCAATATTTACATTAATGT TTAAGCCAACGATGTTCCGACTTAATCTTATCAAAATTCAATTTTCCAGC GAATTGGGACGGTTTCCATGACAACGAGACGGGTATTTTCGGGTACACGT GGACAGTGGGGACGTATCACTGCGATGATGGCGTCCATCCGCACAAGGAC CCGCACTCGCACCTGTACGGGGAGGACGAGTGGACGCACCAGGGACTCGC CTACCCGCTGGAGCTGGACGGTGAGTCAAACATGTCTCTACCGACCACTC AATGGATTTAGAAAAATGGCCGCAGAAGACATGTGGTCACTAAGGTTGCA TTGGTAATGAATAAAATGATCTAGGGACAAAAACAGTGACCATAATGGAC AGATGGTCGTTTTCCAGAAGCCATTATAACTTAATGGATGAGATGAAGTG TCTAACATTGTTGAGTGTGTATCCAGTTCCTTAACAAGCCTTCTTTCTGA AAAATGTCTGGAAATGGCCACATTAGACACTACAAATCCGATTCTTTTAA AGCGAATAAAATCATCTAAGAGACCACAAGAAAGCGGACAGGTGGTCCTT ATCTAGATGCAACCAAAAGCACCAGTCATTATAAAATCTTGAAGCAAGCG GATTAGATTATGTGTCTAATATTGTTGAGTGTGTATTCAGTTTTCTTAAC AAGCCTTCTTTCTGAAAAAAAAATATTGCGCATAATGAAATATTGTACAT AAAGAAAAATTGCTTCAATCGAATAGATGGCTTCTACCACGTGTCCGTCC GCGCCTTGAACAAGGTTGAGTTCGGCGGCCCCCTAGCGACCACCGTGTGC CACACCACCCCCTACGTCATCGACACCACACCTCCATTCGTCAACCACGT CAAACTCATCAGTTACGACGAAGTCACCTACGAACTCATTGTGGAGTACA ACGTCAGGTAAGGACCAGTAAACGTTTACAAGCATCGAAATGTAAAGTCT GTCTATCCTAACCACTCAAGACAAGACTTAGGCAGAAGTCAAAATGCTTG GATCAATGGAATAAATAATCTAAAACTTAAAAAGATGATCATCAAAAGCG GCACCAACAATGACCAGGTGAGCCTTATGAAGTGGTGGTCAGTAGCAAAT CTTTGCCTGTTATTTGAGTCTTTTATCCTTTGCCATAATGATAAACAAAC TAGCCATGGTGCCTCAACAACCAAAAAAGAGGTCAAGGGATAGTAAGTTG AGGTGAGGAATGATGATAAAACTGTTGCTGTTCCACTGTTGTAATTTAGT GACCCACTCTCCAACATCCGGGAGGTTGACATCGGGTTGGGGAAGAGCCC CAGGGATGTGTTCATCAAGGACTGGCATCGTCATGACAACCTTACCCACG TGGTCCTGTACTATCGGATTCCGGACGGCATTCCTACATGGATCAAAGTC AGGGCTATCAACAATGGTAAGAGCTGAACCTATGAACGCACACTATAGTA CTAGAACACATGGCTGATGAACTGTATCCCTTCACATAGACAAAGGCAAT CATTATGCTTCTGATGCCTGTTTTACTTCCTTTTTAACCTAGCCAGGTAT CCAAGCCTATGATAGTTCCCGAGTCTCTGCTGCCCTCTCCGCAAATACTA GATCTAGAGGAGAGGACAGAAGAAACTCGGGAGCTATTATAGGTTTGGAT ACCAAACAATATTAACCACCAGCGGTCCAAAGTATGTTAAAGACCCAGGC ATTGATCCTCTGCACGATAAAAAAACCCAACTCACATAAAGATTAAACTA GGGGTTCAAACGGAGAGAGAAAGACTCAAAAGAGTTTTGCATTACAAGTT AAACTTTGTATAGCTGTTTTCTGACAATATTTCCTACTGCGTCCGACCAG TCGACCTGCGAACAGCCAGCCATGCCCCCAGACCCCTGATCGTGGACTTG ACGCCGCCGGTCCCGGGAACAGTGCATGACGGGGAGACCTACAGCAGGGA CCGGGCCTTCCAGGCGGTCGGCAACCGGATATGCGCCAGCTGGAAGGACT TTCACGACGAGGAGAGCGGAATCGGTAACTTTGGTTTCATTAGAAATTAT TTCTACGAATGTCAAATGATCATTGAGGTACTAGTAGTTGTTCATAGATG CGTTATAGAAATTCGATATTTTGGTATCTGCCAAATGTAACTACTGGCAC GAGGACTGCCATAGGATCTACACGATATTCTTCAGTTTTCAGAAATGTAT CAAATCTTGAAAGAAATAGATGCAGTAATGTATCACCAACCAATCAAGCT GAACATACACTCTGCCCAGCTACAGATACATACTTGTTAACGGTCATTCA GCTGTGTATATAATACCATACGTTTTCAAGATTAATCGGATTCTATCTCG TCGCAACGTGGACTGTATCCAACAGTTTGATGTTGTTACTTCCCATTATA TGTCAGGTTTTCATTATATGTCAGGTTTTTACATGTGGGGAGTGGGAACT GAAGTCTATGCAGACGACATCGTCCCGTCCACGAGCTCCCTCACACCCTG TATTGTATGTAACAGTTTGAATGTTCTTTCCAACTATGTCAGGTTTTTAC ATGTGGGGAGTGGGAACTTCAGTCGGTGCGGACGACATCGTCCCGTTCCA CGAGCTCCCTCACACCCAGCACGCCGCCTGTACCGAGCTGAACCGGACCC TGCAGCACGGCGGGACCTACTACAGCACCCTGGTCGCCTTCAACCTCGGA CATGCCATGAAAAACGTGTCTGTCTCAAGCGATGGAGGTACGAGAGCCCT TTCTTACTGCGGTGTTTTAAATGGAAGATTGTCAAGGGTGGTTGGGGCTA CGTGGTCGACATATTTGGATGGTCGCTTGGAATTTGTAAAATGGCAAAAT ATGATGAACAGTAACAGTAGCGATAACATCAATACACCAATAACCACTCA ACAGAGGCGGGGGACGGTACAAACTTCCCTACACCTTTGACCAATTACTG ACGTAAAGTCTCGTGTCGGTAAGGTCACGTGTCCTTTGTGATTGGTCATT GGTCATTGGCCCTGATGAAGACTGCAGTACGCACAGCCAAAGACGTGTTT CTGCAAATTGTAGTGTTATAACAAAATGTAGTGGTTTACTTCAATGACAG TTCTCGTTGTATCCAGTATTGTATGACGCCACCCCACCGGAGGAGGGCTG GGTGAAGGACGGCCTTGACCCTGACAATGACGTCACGTACTCGTCCGAAA CGGCGAGCGTCAGTGCGCTCTGGGGAGACTTCCGGGATCCGGAGTCCGAC A

Coding sequence (CDS) from alignment at Sc0000001:3634195..3638545+

>transcript:BL97098_cuf9 ID=transcript:BL97098_cuf9|Name=transcript:BL97098_cuf9|organism=Branchiostoma lanceolatum|type=CDS|length=642bp|location=Sequence derived from alignment at Sc0000001:3634195..3638545+ (Branchiostoma lanceolatum)
ATGTGGGGAGTGGGAACTTCAGTCGGTGCGGACGACATCGTCCCGTTCCA
CGAGCTCCCTCACACCCAGCACGCCGCCTGTACCGAGCTGAACCGGACCC
TGCAGCACGGCGGGACCTACTACAGCACCCTGGTCGCCTTCAACCTCGGA
CATGCCATGAAAAACGTGTCTGTCTCAAGCGATGGAGTATTGTATGACGC
CACCCCACCGGAGGAGGGCTGGGTGAAGGACGGCCTTGACCCTGACAATG
ACGTCACGTACTCGTCCGAAACGGCGAGCGTCAGTGCGCTCTGGGGAGAC
TTCCGGGATCCGGAGTCCGACATGTGGGGAGTGGGAACTTCAGTCGGTGC
GGACGACATCGTCCCGTTCCACGAGCTCCCTCACACCCAGCACGCCGCCT
GTACCGAGCTGAACCGGACCCTGCAGCACGGCGGGACCTACTACAGCACC
CTGGTCGCCTTCAACCTCGGACATGCCATGAAAAACGTGTCTGTCTCAAG
CGATGGAGTATTGTATGACGCCACCCCACCGGAGGAGGGCTGGGTGAAGG
ACGGCCTTGACCCTGACAATGACGTCACGTACTCGTCCGAAACGGCGAGC
GTCAGTGCGCTCTGGGGAGACTTCCGGGATCCGGAGTCCGAC
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97098gene:BL97098Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97098_cuf9-E1BL97098_cuf9-E1-1564476830-24009Branchiostoma lanceolatumexon
BL97098_cuf9-E2BL97098_cuf9-E2-1564476830-24011Branchiostoma lanceolatumexon
BL97098_cuf9-E3BL97098_cuf9-E3-1564476830-24013Branchiostoma lanceolatumexon
BL97098_cuf9-E4BL97098_cuf9-E4-1564476830-24015Branchiostoma lanceolatumexon
BL97098_cuf9-E5BL97098_cuf9-E5-1564476830-24017Branchiostoma lanceolatumexon
BL97098_cuf9-E6BL97098_cuf9-E6-1564476830-24019Branchiostoma lanceolatumexon
BL97098_cuf9-E7BL97098_cuf9-E7-1564476830-24021Branchiostoma lanceolatumexon
BL97098_cuf9-E8BL97098_cuf9-E8-1564476830-24024Branchiostoma lanceolatumexon
BL97098_cuf9-E9BL97098_cuf9-E9-1564476830-24027Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97098_cuf9transcript:BL97098_cuf9-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000001genomeSc0000001:3634195..3638545 +
Properties
Property NameValue
Transcript idBL97098_cuf9
Biotypeprotein_coding