Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL97090_cuf33 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL97090_cuf33
Unique Nametranscript:BL97090_cuf33
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL97090_cuf33

>transcript:BL97090_cuf33-protein ID=transcript:BL97090_cuf33-protein|Name=transcript:BL97090_cuf33|organism=Branchiostoma lanceolatum|type=polypeptide|length=871bp
KSPIAKDSIIRWRPRIKKDARTDCSSTKMELRTVVLFALVAGGFSVPLSS
VTDDQCSRHCTESNVLDYRIGRTYRYRYDAKTTTQLVGSSDETSGLEIAA
TVDLEVLSKCELVLRLSDVDLKEASRQALMVTSSNKREFQRALERHPLRF
SFQDGIVPEICPSAEDEPWVVNIKRGVLSALQNSYLSQRRTDMEETDVTG
ACDVQYEPVDERGLTTQYRRTRTFQRCSDRRLGSETGIQANFYHKQTERP
HILDSNQECTHTVDSNSLIESVTCTERHLLRPFSHGQNGATVRSTQKLQL
TPQRPRTKSSLLSGLGFIRSDLRFQHDSDDSQSASGRVEQTLRDLCAQTA
EGVRPETPALFSRLVYQMRDMNVQEMRSVIARAEGICNSDPEKMKKFAMD
AVPLVHNEASARLVKEYIMKGEVTGEQADAWLAAQVFAKNPTPQMIAELQ
PLCEGREVRRSAYLSLSALIHKYCQAESDCAQRPEIRNALAVFERNLGER
CHSFSDKEEEKVMMSLKAIGNAGQAVSAAPTLSQCVLTDANPIPVRRAAM
EAFRRLPCTVSRTALTNTFMNKEEDSEVRIAAYIQAALCPSHDFFQIVKR
AMDSEESSQVGSYVWSHLQQLQKRHDEFHNTVSDILRNSELEKKFTGDKR
KFSSAWEGSVFSDRWNMGGEAQADLIFSDTSFVPRSARLNLTAMVFGAEF
NMLEMGGRIEGLSYLVESFFGHQGYFPENNVLHLLKTKEKRSVLKENKLE
EVHRKFNAKQENQPEGSYYVRMYGDEMMYGDFKGLDVQAQKQGWNVMEMM
MKLAKQQDYEVTKSTMFLDSTHTIPTSTGLPLRLAINGTATTHVKVSGKM
DVRNMGFSPRSMHIEGQVMPR
Run BLAST on NCBI

mRNA from alignment at Sc0000001:1134070..1158082-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL97090_cuf33 ID=transcript:BL97090_cuf33|Name=transcript:BL97090_cuf33|organism=Branchiostoma lanceolatum|type=mRNA|length=24013bp|location=Sequence derived from alignment at Sc0000001:1134070..1158082- (Branchiostoma lanceolatum)
TAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCA AGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACC GTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGGTAAGAGAATTTC GTCTTTTCTTTTAGCGATCGTGTATTGTTTTCACGGAGAGCGCTTGTGGG GAGAGAAAGGAGAGCGAGCGCGCCCTGTGAGAACCCGGGGGAACGTAAAC TTCCTGCGCCGAAAACAAAGTTGCTCCCTCCCCGGTAGAAACACCCTAAG ACTCCGGTTAAGGAAATCTTGAGTAGCAGTCTACGAAATGAGATATTTCT TGCCGTGTTTACAGTAGAAGTGCGCTGAACGGGCCTCTCAGCCAGGCCTG TTTTCAATCTGGGTACCCGATACTACCCACAGTCAGCTGTTTGTGACAAA GGGCACTTTAATACCTTGGACTCTGACCCAACCACTAGAAGTGATCCGCA CGCACACTAGACAGACTCAGAACAATGAAGATTGCGAGGTTTAAGTTCTT GTCTTGTGTGGACCGTTCTAAGACGTCTAAGTGGCAGAAGAAGCGGTATC TTGAGGTGTTATCGCCTGCGTGAGCCGTGCACAAACAATAGGGGATGCGA GGTTGTTTGTCGCGGGGAAAAACTGATGACGAAGCGAAGTTGGGCAGAGC GCCGAGCACCCTCAGCGGGGGAGGGCTTCCTTTTACGGAACAATACTTCT TACATGATCGATCATTAACTCATGCAATGGAGTTAATCTAAAAACGGTAA TGAAAAACAGCGTGTTGCCATTAAAAACCCATAGCCTTTGTTTCTATGAG TTTTCTGTTCTAGCGCAGCGCCTTTGTGTGACGTGAACCACAAAGCCCGG AGGCAAAAAAACAACCCGGGCGCTTTTGTCAAAGTTTTGGCAGCGATCTC TTCTGCGTTATTCCCTGGGCGCAAAAGGCAACAACAGAGCGACCTTAATT GCTACATACACGATGTCGCAATCGGTAGTAAAACCTGCTGATGTGTTGTA TCAATTGTGTGGGGTTTTTAGAACAAATATTGAGTCATTGATGTAACAAC TTGTTCCTGTTTTTGTTGATTACAGTGCCGCTATCGTCCGTTACAGACGA CCAATGTTCCCGACACTGCACAGGTAAGGTGGATATTACATAACCCTTTC TTTAATATTAAACACACACACGAGAAACATTTAAAGCGCAGAAACATCGT CCCTGGCTTGGAGCGTGCGGAATTTTTTCCTCGCTCAGAGTCCGCTTCTG AGATTTTAAAGTGCGGAGCCGCAATGTGTACACACGGGTAGCGGGTAAAC TCGGGGGGCAAGGTACAGGAGATAACGGGGGTAACTTTTATCTGTCTTTC TGTGACGTACGCTTTGATTTACTTTGTTAGTACTTGTGCTGATAGTGGCT GTATGATGTTAGAACGGTGTATGTCGATAGTTTGTTATTTGGAGGGGATT TTCACACCGTATGAAGGGATGGTTTATAAAGAATCTCCCTTGGGAAAGGA AAATTGTTTAATTACGCTGCTCGGAGGCATTACGGGAGGTAAACAGGTCC GGACAATAGAATGCGACACGACAAATTTGGCGAGCAAAGTCCCGGCGGTC CCGTTTTGGGCTACCATCCAAAACCCGCCCGAGTGGAACGAAGTGTCGGG AAGACAATGGGAAGAAGTAGCATCTGGCCGCCCGGCCTTATCTTCGAGTA ATCTCCAAGCAGATGTGAAGAGGCTCGGTTTTCACGCGTATTTTTGTAAC ATTCTATACGCCTTTCTAGTATTGCAATTTTTGAAGGTTTTGCATAAGGC ATACTAAATGTTCTTAAAACACATACTGATGATGACACGAATCCTTACAT TTGCTAGAAGATAAATCTTGAAGTTCATATAAGGCTTTGTCTTCTGTGTG GTGTATAGTGTATTTGAACGCCTCTCAAGACAGCGGATACATAAGTAAAG TACCGCATGTTAAATCTGTGCATCTGTTTGTAGATAAGGGCATCTGATAG ACACGGGCTATGCATAAGAATCTGTAAGCCTGTCTTGACAATGGCGACTG GCCAGAAAGGTGATGCAATACTTGTGGGGAGGGGTGGGGGGTGAATCTCC GGAAATAACACGGGGGAATCCGAGATGGACGGGTTTGCCTAACTCCTCGT TCTAGCCGGCGGACGTAGGGAACTTGGCTGTGTTTCTTGTCGCCAGACGG ATTCGATCTCTGTGTGGATTGTAGGGACCATTGGCTTCTTTTCAAAAGTC GGTCTGTTCGTTCTGTATGTCTCTCAAGCGGTGCGGGTTTTTTTTAAAGG ACACTCTCAGATGAGTGAAAAGGCTTGGAAAAGATGACTGAGCAACATAC AAAAATGGAGATATCGTACATGTCTGATTGAAAGTTGTAATGAAGAATTG TTTGTAAGGTTTAGAAAAGAAGATGTGCATATGTCTGGGTTGATTTGAAT GAACCCGAAATGAGGTTTTGTGTTTTTTAGCCAATGTCGACCTTTTCTTG TGGACAAGGCAAAATTGCTCATTGTTACCAACACAAAGAGGAACTCTGTA TTAAACGAAGCGATCACGGAAAACGGAAAACAAGTCTTCGGACAAAGGCA TTGTCATCAGCATTAGGCGTTATACATGAGTCCTTGAAGGTTTAGTCCAT TTCTCAAGTGCGACTTGGGTGATCGAGTAATCTTGGCTTGTGTCGAGAGT CTGGAAAAATAAACCTAACGTCGCCGTTGTGATTCTGAGGAGGATTTACA GATTTACATAGATTATGTACAGAAGGACGGATTAGACCCGGGAAACCCGA TACCTTGTTTTCGTCCCCACTTGTCGACGCGCCAAAATCCAGCCACGGAT CTGTACGGATATCACATATCACGGATCGTTTTGCTTGGTTTAACAGCAAC AAAGATGAAGATATGAAGACTCAATGCTAGAAGATAAAGACATTGAGTTT CGAACGCTGTTTCTTGGCTTCGTTAAATGTCCTTTGTTGTAACACCTGGA ACAACACTTGTTGCGTCATCCTTTATGGCTGCTTGTGCTGTAGTTCTTAT GAAAACCGCTAGATGTCTCTAAATCTAACTTGTTATTTTTTGGCGGCGGC CTAGGGGCGAAGCCTAAAACCTCAAGGTACATGTAATACTTCGGTCGTCT TGAAAATATCATTCCAATGCATTAGAAGTCCTCATTGTTAGTGGGGGGGG GGGGGGGGGGGTATAGAGTAAGACAGAAACATTTTTTTACAAGCTAGAAT AGATCTTTATTTTGTGTATTCATATTGTTTATTGTTGTTTACAGAAAGCA ACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCA AAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGA AATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCC TCAGGGTACGTCACGCGCTCTCGTTCCTAGTCTAATGTATACCTCTTTTT GTAGACCGATATTGTGATATCTTAATGATTTGACCTTCACATTTTCCAAA GAATGACATTGTCACGTATGATTATTTGTCTCAACAGTTAAACGACCTTG ACCTAAAAATGATTTTTCTTGAAATCTGTCAACATTTTAAGCAACTATTT ACACACTTTTTAAAGAATGACCTTGCCCCAGCTGACCTTGTGTTTCGCCC CCCTCCCACAGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCT CTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAG ACATCCTCTCCGCTTCTCCTTCCAGGTAAGAAACTTGTTCTCTCAAATAC ATTTGGATGTTTCCTCTCTCCCCCTCTCTCTCCCTCCCCCTCTCTCCCTC TCCCTACCTTCTTCTCCTACTCTCCCTCCCATCCCCCTCCCCTCTCTCCA TCCCCTCTCCCCTACCCCTCTCTCTCCCTCTTTCTCCTTCCTCCTCCCCT CTTTCTCCTTCCTCCCATTCCTTCCCCTTCTACCTATCCCTTTCTCTCTT CCCCTCTCTCTACCATTTTCCTCCCCCCTCTCTCTCTCTCTTTCCCTCCC TAAGTTTACTTTCTTTCCTTTTCATTGAACGTACACATTGAACGAAAACC AAACAGAATATACATGGACTAAATTCAACGCTCAAGATGCGTAAAGTCGT CCTCCAACAATCCTCCATTGTCCTTTGATAACGGTACGTAGGGAATGATT GATATACAAACCTCCCTGTTGCCCTAGGATGGAATTGTCCCAGAGATCTG TCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGC TGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAG GAGGTCAGTTACTGCTTGTGTGTTTGTTTGTTTGTTTGTTTGTTGTGTGG ATGGGTAGTAAACATTAGCAGGTACTGTATCGCAACAGTTAAAGTTTCCT GAAATATTTTCCAACATGGAGGAGGTGTAGCCTCCGTTGCAGTCCTTTTC CCCGCAGCTTTTTTTTTTCAAATTTTTTTTTGGGGGGGGGCGCCGCGTAT CTGCTTGGGACCCCGTATCCGCCGTGCCCCTGTGTCCGCTATAGACCCTG TGTCTGCTGCTGGGGGATACGCGGCGCCCCCCCCCCCCCCCANNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGAGGCTAGAGGAGGTG TGTGCATGGGTACTGAACATCGGCAGGGTAGAATGTTGTGTCGAAGCACA GTTAACGTTTCTTGTTATATCTTCCAACGCAATCTAAAACACTGCACACC AAATTTCGCGCCATCACACCCCAGGAAAAGTGACCCACTTTTTTGGGACA CATGGGCCAAGTAGTCGGGCCAGAGTCCAACAGTTTCACAGTAGCTGACG AGGAACTTTTGTATGTGTGGTAGTCTGGTATCCAAACCTATAATAGCTCC CGAGCCTCCTCTGTCCTATCCGCAAATAGATTTGCAGAGAGGACAGAAGA ATCTCGGGAGCTTTTATGCTATATANGAGAACAGAAGAATCTCGGGAGCT TTTATACTATATAGGTTTGGATACCAAGCTATGATGTGTGGATTGACAAA CTAGTCAACTTTGCGGTTTGCTAGTCAAATATTTTTCATTCAGAAGTTTC TAAGAGTGTCCTTGACCTCACAGTGTGCCTTACAATCATTTTATTAAATG CGCGGGAAAACTCATAAAAGACTAGTTGCTTCTCTAGAGATTGCGCAATC ACAGTAGCAGGTCGAGATTGTCCATCTAGAGCTGCCCTCTCGCTCACACC GGTCGATCAACTGACCACACGGTAGATAGTGTCCTTGACGACAGCACACA AGGTCGGCAAACAAAGATGGCGGACTGCAGAAAAAACGTGTTCGGGCACA TTTGTCCCAGATGGCCTTTGAGGTTAGCTTATCCAATCGGAAGATTGTTG CCTTGGCAACGGTAGAATCGCATTGTCTTAATGACCGTGTGCGGGACAGC TAGAAACGTGTTGAGAACTTCTGTCCTAATTAATGAGAGTGACCTTTGTA GTAATTAACTAATACAACCTTTGGTACGCCTCAGTTAGAACAAGTTTTTC CGTAACTGATGCAAGATGGAAATCAACGCTAACTTTGCAGATGCTTTTTC CGAGTAGTTTTTATTTGTCACTCTTTTCACCTTCGAAAAGTTTGTAAAAT GTTTCTCTTTTGTTAGTGCCATTTTATCATACAGATGCTGATGCTCCTAA AGTATTTAATTACGGCAATTTTGCGATTTCTACAGAAAAATCCATTCTTT TCTTTTAATGCCTGTTTCGAATCTTAAATTTTGTGCTTTAATTTTCGTCA ACATCTGTGAGATATATCAATATATATATTTAATCCTTTTCAGTATTTTT TTTCAAATTTCATGAGAAGAGTAATTTGTTGGACGACCTACTGGTTGGTT GTATAATGATGTGTGGACACAACGTGCGAACTTTGGCTGCCTCACAAAGC GCCAGTCATCAAAAACCGACGCCTCGCCGAACAAATACTCACATTATCGA TCGTCAGATTTGCTTTTTAAACCCTAAATGCTTTTAATCATCAAAATTGG AACAAATAAGTAAGTTATGGATGATTAATGTTTGCTTCCCAAACGTCAGA GTTCGCTGGTCATCGTTTTTCCCTTAGCAACGGAGGAATGTTGGTCAGCA AAAATCACCACACAGAAGCGCCAACAGGTTTTTATCTGCTAAAAAAACGG ACAAAGGTTAAGAAAAGAGTCGTTATCTCTCCGCAAAGAAAACGCTGATA AGCGTAAGTAATTATAAAGATGGACCCTTACGATCCAAGTAAAAATAAGC TTCACAACAACCCTTTTAACGTTTTTCATTAGTCACATATGCTCACATTG GACATACAAAACGAAGAATATGTAGGAAGAGAAATAGAACTAGAAAGGCA ACATTTGCGAGCAAATACAGCATGTTTAGCCATACTCCTCGCCATGCAAA AAATGGACTCTCCCAAAATAACAATGGACCATTCTAAAATACTTGCACTA AAAAAATGAATCACCCCAGTCCAAAATTGAGTCTTCCAGTAGCACCTCAA CACAATATGGACCAGTCCACAACCATATCCACTAATTGATTAACAAATAC ACTTCTGCTAAAAAATGGACTTTTTCATAATCATTCCAGCTCAAAATTGA AAGAAATAATTAAAGAATCCTCCCCTTGCAAGAATGGGATATTCCGTGCC ATTTCCATGTAAACCAGTCGAAAAATATCCGCTGAAAATTACACTCTTGC GCATAATCAACCCAGTTCAAAATTGAATTAAAAAAGATCAACCCCAGGGA AGAATGAAGTTTTCCATAGTATACATATGAAGATTTGACAGGAGACGAAG GAAATGACCAAAAACAACATATTTGAGTCAATTCAAAGTCACCGAGAGGG TTTTAATATAATATTTGTAATATGTTTGAACTATTTTGATTAAAAGAATG TTTAAGTCACAATAGTTCTAAAGTGTTCAAACAATTAGAATTGAAACTTA TAACATGTTTGAACTTATTTCACATACGTTGGAAACATTTCGAACGTAAC TACACAAAAATCTCTTTATTTAGAACAGTTTCAAACCATCTATCCAAATG TTTCAATGTTCGAACAATTTGTAACAAAAGATTTTCACAATTGCCCTCAT AAACGAAGGTGCTAAGTCCTCCTGTGTGTTTCTGCCTATTTTCGGTGGCC GCGCTAGACCACCAGCGGATTTGTTTTGACGGAGCGTCACCCGCGCGCGA CGATGTACACTGTTCGGCACCGCTAATATCCGGCATTTTCCCGCTCCAAA ACACTCCACAAGACCCACGTTTTTAGTGTTTTGCCTCTTGTGCAACACGA TTCGATTTGCATTACTAACGGGACGAAAATGATAGAAAAAATTCACCCCG TCCCGGCGTCCGTCCCAAAAACATGAACGACATGAAAATATATTTTCTTA CAGATTCAATCACGAAAATCAACAGCATGGGATTCCAAATTTTCGCAACG GCCGACCATTTATCATGGTTGAACTTCCTTCCAAGGCGTGCGATAGATAA ACATTCCCGGCACATAATAGTCACTAGTACCAGACTAACGCAAGCTCATG ATGATAATAGGGAGAAAGTTTGTCAGTGAAGTTTGGCCACCAGAGGGTAC ATTCATTTAACGTTACAAGCTAGCGCAAAGGGGCGAATCATTGACCTTAC CGGGGACTGACTCTACTGGCCTAATCATTCCTTTTTTGCCGAATTCTACG ATCCATACGCCCGTACGTAGGACATGTAGGAAGGCCTGGTGGTGGACGCT ACACATCACGGGAGACGCGTGTTGGTCCGAGACAGACAGCGGCGTGCTTT CGATCGCGTAGCGGCGACGCACCGCTGCGACAACGTGCGGGACCAAAACG CCTGTCCCCAGTGAGACCATGTGTTTTGCGCGGCATGCCCCGAATCCGTC TACCATTGCTGAATGTAGCCCGATTCATAGAGGTCTATTTTGTAAGCATT ATTTCATGTACCCCTCAGCGTGAGAATTCCTTGTGCAACACTTCGCTACA TTATATGTTTAAGTTTCCCCGCGCACCGCCTACCACCCGCCTTTGATCAT GTATGAAGTCGGCGGCAGAGAGAGATCATCAATCAATTTTGACAGGAGTG TCGCGCCAGTCTGAGGAGAAACGATCTCCCGTGTTGTGTTGAAGAATTTG GAGTTTGAAAATATCTGGAATAACTAATGCTAGAATAAACATTCACAAAA TCATTGATTTAACTTGTTTTCTGTTATAAAATTTCCTAAACTGCAATTTA ACCACTGAGTTTAAGGGAACATGGTGTTTTCCCGATAATCACGTTAAATG TTTATGTCCGGTCTTTCCTCCTCGTAAGCAAACTTCCAGCTTGGCCAGGT GCAAGGCACTCGGGGTCAATGACCTGTAGGTCATATGTAGTATTGAAAGT GACAGAAGTGGCAAATATTGTCAAGAAAGCCCAAAATAAATCGTTTTGAA TATATGTATGCCAAAAATGGGAATGTAGTCCTTTAAATATTTGTTCAAGC CACATATACAGCAAATTTCAGGTCATTCGGTTGAAATACCAGGGCGCAGG AGGCCAAGATATGCTAAAAATAGCCTAAAAACCTCAATAAAATCACTTTC AAGGTCAATATCAAAAAAAGGAAAAGAACGTACATTGGTTTTTGCCTACA TTACCTCTGTACCAAATTTCAGGTCATTTGGTCAAAAAATGACAGAGATG AATCGATTTGAAGATTTGACAGGAGAAGAAACATGAGAGAAAACAATATG TTGAGCCATACTTATGGCTAAACATAACTATAGTAAAGACGTAACGTATC AACGTCTTGTGCTGCAAATATTTGCAAACAAATCTGAGATCTGACGACGC GAGAATCGATTTTGTGTCAGGTGTAAGTGCCACGTGGCCGCTCCCTCGGC CGGGTTAGGGAGAGGTGCCGCACGTGGAGCCGCCTCACGTTGCATGGGGT GGGAACGGCCGTTCGATGGTCTCCAAGCACACGTGCCGACTTCTTGGTCG ATTTGTACGCGTTTTATGGTGTAAAAGTAGCGGAAGTTACATCGTCTGTG AAAAGATCTGCCACGTGAAACACGTAAAAAAGATAGCCTCCATAGCAGAC TCTGAACCGGTCTTAATGGGGGCTAAATAATACACCTTTTGCAGCCAGCC CGTAACCATCAGCCACCCCCGTAGCCGGCTGATAGTTACAGGGGTGGCTG ATGGTTACGGGTTGGCTGCAAAAAGTGTATTATTTAGCCCCCCAAAAAGC CGGTTCAGAGCCTGCAACGGAGGCTATAAAAAAGAGACAAAAGACGCAAA ACAATCATATTCTTTAGAATACACATGATATCCTTTTGACACCCAAAATT AAATGCTCCAAAAGTGATCGGACGTTGCACGCCATATATGATCTCCATGC AGGTCTACGTGTGATTTAAGCGTCGGTCTGTACGCGTTTTAAGTTCTAAC GGTAGGAATCATGATACGGATTTTGTGTGTGGTGTGAAAAAGACGTTAAA AACGTCAAAATAAAATGCAATTCTGGTGTATATTTTGGGGTAGTTTGATG AAATATTGACACTGATTTTTTTTCATAAGGGGCAGATTGTTATTATGCAC AGCCCCTGTCTTGTATCGCTACACGGCGGCGTAAAAAAAACAACCCTTTT TTATGGTAGTGTCACCTCACGCGAAGTAGAATTTGAGAATAACAATTATA CTCCACAAAGAATTACACTAACATAGTCTCAACTTTATTTCCCATCCCAG ACCAACGTTACCGGCTGCTGTTATTTTCAGCACGAGATGCAGACTGACAA ACATACTCAACAAAGAACTACACTAACGTAACGTAATTTTCCTCCCACCC CAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGA GCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCT CCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTANAGT CTAACTTAATAAGCAGACCGTAAGTTCCGTAGGGTCATATCATGTACATG TAAAAACGTGCAAAAATCCTCACTAGCGAGTCTGACATCCAGGCCAACTT CTACCACAAGCAGACCGTACGTTCCGTAGTATTACCATGTAAAAACGTGC AAAAATCCTCACTAACAAGACTGGGATCTAGTCTAACTTAATAAGCAGAC CGTAAGTTCCGTAGGGTCATATCATGTACATGTAAAAACGTGCAAAAATC CTCACTAGCGAGTCTGGTATCCAGGCTAACTTCTACCACAGGCAGACCGT ACGTTCCGTAGTATTACCATGTAAAAACGTGCAAAAATCCTCACTAGCGA GTCTGACGTCCAGGCTTACTTCTACCACAAGCAGACCGTAAGTTCTGTAG TATTACCATAAATGTGTTTAACCCTTACAAGCTAGACCGGCATCCAGGCT AACTCCTACCATAACCAGACAGTACGTTCTGTAGCATTATATCATGCAAA AACGTGTTAAAACCCTCACTAGCTAGACTGGCATCAAGGCTAAATTCTAC CACAAGCAGACTGTAAGTTCCGTAGTATCATAACATGTAAAAACGTGCTA AAAATTAAAAAAAATGAAATCAGACTTACTGGAGTTTAGGCTGTCACTTC AACCTTCGTCGATTAGGATGACCCATTACATTCAGCACGTGGCCTTATGG ACTCAATGTGACTCTTACTAGTAAAGTGTCAAAGTTGCCAGAAAGTCGGT ACCGTCCCCCGTCCTCGACACAAGGCCCTGTCGACGAGTAATCGTTTTCT TAGACTTTAATTTCAATAAACGTATTTCTAACGTGTTTTCTTCTTTCTCC CAGGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCACACTGT CGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGC TGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAG AAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCGTAA GTTTTTACCTGCATAAAATATGGAGGTATTATTTTTGGCGTGTCTGTGTT TCCGAGTATTTGTAGTCGGCATAACTTAAGAACCTTTGGAAGGATTGTGA TGATATTTGGTCTAGATCGATTTTGGGCCTCCTGGTGTTGTTTTTTTGTT GTATATTTGGTCTTGGACATGCGATGGTCTTGTTAACGATCCTTCTCTTG TGTTAAACTTTTAGTTATGTATTTTTCTTCTATTTTCTGTCGTTGTGAAA TTTAAATAACTAATTCAAACATACTTGTCTCCTTCACAGTGTCTGGTCTG GGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCA GTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGA CCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTG TACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAG GGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGTACGTATGAC GTATGACACATGACGTAGGATTTTTGCGCTCACGTGACACTGACGTCATT TCCCGTCAGCCATTTTAGTAGGTTAGAGATGCATGCAAAGTCATTAAGAA AAAAAAAAAAAAAACGTTCCTAATGCGAAGGGCATCTGCAACAGCGACCC CGAGAAGATGAAGTACGTATGACGTATGGCACATGACGTAGCTTTTTTGA GCTCACGTGACTGTGGCGTCATCTCCCGTCAGACATGTTGATTGGTTAAA GAAATGTACAAAAATCGGCCTTATATACTTGTAAGTCAGAAATCGGCTAA AGTGAAGCCGAGAAGATAAAGTATACATTGTGTTGAGTTTTTGGCTCACA CGTGACTGTGACGTAGCTCAGCGCCCGCCATGTTGATTGGTTAAAGAAGT CTAGAGTTTCATTTTGTATCAAACGTTTTTGCGTTTTCCAGCAACTGTTC CTGGTCTCTCCTTAATATTTTCGTCATTGCTGCTGGTTCGCATATAATTC GAATGAATTTACTATTACGTGCATCCTTTAGTGCGGCGTTTTCTGACCAA GTTTGTTGTTTGCCCTTACCCAGGAAGTTCGCCATGGACGCCGTCCCCCT GGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGG GCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTC GCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAGGTAGGCTGATG CAACAGTTTTTACCACATGCCCCAATTTCCTGATGTGGAAATGTAGAAAT CTGTTATGATATCCAAGCATGTAACTAGTATTCAACACATGGCAAATCAG AAGGCTTTCAATATAAGATGAAAGAATTCTGCATATACTATCTCACTTCA GAAAGGGGTCAGAAATGCCTGGAAGCCTGTTTCAACCCCTGTCCCGTGTA CATGTTAACTGATTCTATTTTTACTCCGTAGCCCCTCGCTAGGCCGCTAG GTCTGCAGCGCCGTCTACCTGCCCCTGTCATTTGACACGTGCCTGGAAGA CTGTGTCACCCCCCGTCTCTATTAAAAGATGATAACATGTCAACCGATAT CTGTTTTCCTTCTTTAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCC GCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTA GCCTGTAGCGCCCCCCGTCCCGTGTACATCTGTAATAATGTCTGCTTCCC TCCCCAGCCCCTGTGTGAAGGTCGTGAGGTCCGCCGGTCCGCCTACCTGT CTCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCC CAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGG AGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTACTGGTTT AGAAATGAGTGTATGAATGAATGGGTGAAAGACTGGGTGAGTGAATCATG AACGCACTTGTGTAAGAGACGAAACAGGGATAGCACTCTCATTCTTTCTC CGATGAATGAATGATTATGAGTGAACGAACTAAAGAATAAATGAATGAAA TAATGAATGAATGGAAACATCTTCATTATCACCTAACAAAGTAAACGAGA AATTTGACTATTTTTAGATTAGAATAAAGCTCTCACAATCACCGAGTAAC TCAATGAGGATTTATTGTCGCTGTTGTTGTTATTGCAAAGTTTCCAATGA AAATCTATAACACAATTCTTAAAGAAACAAAGAAACAAGCAATGAAACTG CGTCTCTCACGACTGACTATTACAAATACGCAACAGCCACAGACTATATA CCTCCCAAGCGAGGCCCTAGTAAGTGCACGTGTTATACCACATGAGTAGT ATCGTAATTTTCTTGAAGTCTGTCTCACGAGTCACGACTGACTGTTCCCG TGCCCGCAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGC CGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACC CCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGC ACCGTCAGCGTGAGTACCTGACCAAAATTTCACTCAGTCGATTTTTTCTA GATTCTTAGATTTTTAAATCTTAAGACCACTGCATATACCTTCATCACAA GAAACATCAACAAACAAGTTCAGTCTGATTTATATTCAAAGGGTCTCCTG TATTCCAATGCATCGTAATACTTAGAATTAACGTTACTATCGTACTAACT TGCAAAATCATCAGCACTTCTTCACCGAACTTTTACGAAATCCGTGAATT TCTTGTACTGTTCCAAGATAACTTTCTTGAGTTCTGTTGACAATGCACCG CCTTCATCAATAGGGAGGACGGATATGTCTACAGACAGTCTAAGTTTTGA AGCTAGAAAGACAACCAGGACTAACCAGAAAAAGAAGAAAATATATCTTA TGTTCTTCCACTCCCTCCCTGAACAGCGCANGACGTCTTACTGACTTTCT TAAACCGTTCCTTACACAGCGCACCGCCCTGACCAACACCTTCATGAACA AGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTC TGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGA GGAGTCTTCTCAGGGTAAGACACTGTATTTCTTAAGCTTCGGACCATCTA AGACGTAGTTACGTTGATAAAGGTTAGACATCCAGGTAATAAGATGGGCC AAAAATAGTTGAGTACTTATTTTTGGCGTAAGACGTAGTTATGTCTTCTG CTCATTGTGAAAGCACTCCGTCTGAGCACCATTGCCGTTCAAGTTGGCAA GTTGGTTGTTGTGTCACATCTACACCTCGTAGGTTCCGACGAGTGGCGCA ACACCGTGTCCTGTCGCACGGTGGCGCTGCGGCACGGTGGTCCCAAACCT GACTAACATTATCTTCTCTGTCCCGTTCCAGTTGGTTCCTACGTGTGGTC CCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGT CCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAG AGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGGTGAGCGAAT CCTTACGTCTTTATTTGATAGTTAATTTTTTTTCTTCAATAGTACAGAGA GATAGGCAAACGTCAGATTGATTCGTTAGAAGACATGCAACTACAGTAAG GACAAAGCCTTTAATGTTATGGACTAAGTGTTAGTGTTAATATTATCTCA TGTTAACTATCCTATTGTTTTCAACAGACCGTTGGAACATGGGCGGCGAG GCCCAGGGTTAGTGTTAGCGTTACTGATGTCTAACCCGTTTTTTTGTCCC CAGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCC GACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGT CTTCGGCGCAGAGTTTAACATGCTGGAGGTCAGCTCACGTTTCCTTACTG CTAACTCAGTTGTTCTGTTAAAGCATGAACGTTAGAATTTTCGTCTTTAC ACAAGCTCCACTTTCATGACTTTTATTAACTCAGTAGTTCGGTAGAATCA GTTGACACAATTATTACGAATCCTGTCAATAGCGACCACCTGTCTATACC AGATATCAGATCGGTCCCCTGAGTGGTCGTCTTGGACAGGTTTGGCTGTA CTGGTATTTGTCCAAACAAGACAACTGAATCGAACATTTTGTACAGTTAC TTAACCCTTAAGCTGCCAGTCCCAGTTTAAACAGGGATACAGAAACATGC CTTATGTGCTGCACCCGGTTATAACCGGGATAGGGTATTCCCCAGAAGAA ATCAGCTTTGCGTGCGTGTAGCGCTCGAAGCCTGGAAGTTAGGGGAGTTA GGGTTACCGGCTGTTTTGCGGGTTTCGTGAGGGAGGTCAGGGGTCAAACA TTTTTGATTTTTATTTGCCTAAAAAGAAAGATGTTAAAGGTGTTTATTCC TTACCTCGCCACACAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGG TCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTG CACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCT GGAGGAGGTCCACCGCAAGGTATGTGTCTTGAGATTCTGGCCAGTAATCT TCGAAGGCCTTACACAAGCTAAGACTGAGTCAAATTAAAATTAAAATGAA TAAAATTGAAGAAAAAAATTGAAAGAATCAAAGAACAAAAGACATCATAA TCGTACATCACCATCAATTGCTTAGTGGCATCGTATTTTTAAACTTTCCT GGAAGAATAACGTAAAATGTATCTCTCTTTCACGAAAATAATCCTAATGT TGTCTATACGTGGTTAATGATGCTATGTGGTTGCAAGCATGGTCTCTTGT GGAAATGACCAGGGAATTTTTCACTTAGCATTTGATGCCAAATTTTATAC CAAGAAGGGTGACAGAAACGAGGGAGACCACAACTGTTAGACGTAAGATT TAAGTTTAGACTTGATCTTGAAACATCATCCCGCCCTCTTATTAGTTAAA CATCAAGACCAAGAAGAATGACAAAACGTGGGGCACTTATATGTGTAATT TAAGACTGGATCATCACAATCTTTCCTCCCCCTTTTACAGTTAAACGCTA AGCAGGAGCACATGTTTAATGCCAAGTAGTAAGCACTGTAGAATGGGCAG ATATGAGGAGGTCCATAAGACCAAGAAGGATGAAAAACAAGGGGACCTAC CCGTAGGGCACTTAAGATGTAATTTAAGACTGGATCATGACACAATCTTC CCCCTCCCCAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTAC TACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCT TGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGA AGCTGGCCAAGCAGCAGGACTATGAGGTCAGCATCTGTCTCTCTCTCACA TTCAGCTGTTTTCCGTCTAGAACTTAGACGTACATGGCTGCTTGTGGGTT CAGGGTACATTTAAGAATCAAGCGGTGTGAAACACCAACTACATACATCG TATGATGAAGCTGGCTAAGTAGCAGGACTATGAGGTCAGTTATCTGTCTC TCTCACCTTCAGTTGGTTTCCGTCTAGAACTTAGACGTACTTGGCTGCTT GTGGGTTCAGGGTAACGATACATAAAAGAACCGTTCAGATTCTGGATGTC TTCATTGATGTATTTGTATTACCTAGTACTGTAGCTTATAGATGTGTCGA TTCCCTGCTTATTCTTGGAACAGTGTAGCGTAGGGTACTTAAACACATTT AAAGCAAAACTGACTCTAAGTAAGGAAAACTTAAAAAAAAAAAACTTTAA GCCAGAAGAGGAGAATCGTTGTATAGCTACGAACATACGAACATATGTGT ATTTTACTACGTTATGCCATGTGTATACAATGTTGCAACCCTGTGTAACC TTATCCTTGGTTTGTCGTGTTTCTCGCAGGTGACCAAGAGCACGATGTTC CTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCT GGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATGG ACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAG GTCATGCCCAGGT

Coding sequence (CDS) from alignment at Sc0000001:1134070..1158082-

>transcript:BL97090_cuf33 ID=transcript:BL97090_cuf33|Name=transcript:BL97090_cuf33|organism=Branchiostoma lanceolatum|type=CDS|length=49647bp|location=Sequence derived from alignment at Sc0000001:1134070..1158082- (Branchiostoma lanceolatum)
AAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCAA
GAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACCG
TTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCC
GTTACAGACGACCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTCGA
CTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCAAAGACGACGA
CACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAGCC
ACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAG
TGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTCCT
CCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTC
TCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGA
GCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACT
CTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTTACCGGC
GCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACGCA
GTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCA
GCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTCCC
CACATTTTGGACAGCAACCAGGAATGCACCCACACTGTCGACAGCAACAG
CCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCT
CTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGCTG
ACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTT
CATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTCCG
CCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCGCC
GAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCA
GATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAG
AGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGGAC
GCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTA
CATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCG
CCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAG
CCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTC
CGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCC
CCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGG
TGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAA
GGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCC
AGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCATG
GAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACCAA
CACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACA
TCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGC
GCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCA
CCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTCCG
ACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGG
AAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAACAT
GGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGTGC
CCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGTTT
AACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGA
GTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCACC
TGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAG
GAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTC
GTACTACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGG
GGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATG
ATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATGTT
CCTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGC
TGGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATG
GACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCA
GGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGA
GACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATG
GAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGT
GCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGACACTGCACAGAAA
GCAACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATATGAC
GCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTT
GGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCG
TCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTA
ATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACA
TCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGT
CTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCC
GCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGAC
CGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCG
GCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGAC
CGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCA
GACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCACACTG
TCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTG
CTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCA
GAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGT
CTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGAT
GACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTG
CGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCC
GCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTC
ATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAA
GTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCC
TGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGAC
GCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGAT
CGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCT
ACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGAC
TGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAA
CCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGA
TGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCC
CCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCG
CCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCA
CCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGT
ATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCA
GATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCT
ACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCAC
AACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCAC
CGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTG
ACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGAC
ACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTT
CGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGA
GCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAAC
AACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGA
GAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACC
AGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGATGATGTAC
GGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGT
CATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCA
AGAGCACGATGTTCCTGGACTCCACCCACACCATTCCCACCAGCACCGGT
CTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCACCCACGTCAAGGT
GTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGC
ACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCC
ATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAG
CTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAG
GAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGA
CACTGCACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCTACAG
GTACAGATATGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACG
AAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCA
AAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATC
TCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAG
CGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCA
GAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACG
TGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAG
ACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCT
GTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCA
GCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACT
TCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAA
TGCACCCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTAC
AGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCG
TGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAG
TCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCA
GCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCC
TGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCG
GCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGA
GATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCG
AGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAG
GCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGG
CGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCA
CCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTC
CGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCA
GGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCG
TCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAG
GAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGC
CGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACC
CCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGC
ACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGA
CAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCC
ACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCT
CAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCA
CGACGAGTTCCACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGG
AGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGA
TCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCT
GATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCA
CGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGT
ATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTA
CTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCT
CCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCT
AAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGA
CGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGC
AGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGAC
TATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCACCCACACCATTCC
CACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCA
CCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGC
CCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCAT
CGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCC
GAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTC
GCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGA
CCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTCGACTACAGAATAG
GCCGCACCTACAGGTACAGATATGACGCAAAGACGACGACACAGCTGGTC
GGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCT
GGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATC
TGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGG
GAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGA
TGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGG
TCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGC
CAGAGGCGCACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGT
GCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCA
CCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGC
ATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGA
CAGCAACCAGGAATGCACCCACACTGTCGACAGCAACAGCCTCATCGAGT
CTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAG
AACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAG
GCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCG
ACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGC
GTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCG
CCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACA
TGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGC
AACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCT
GGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGG
GCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTC
GCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGA
GGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCC
ACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGG
AACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTT
CTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTA
ACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTG
ACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCG
CCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGA
ACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCG
CTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTC
AGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGC
TCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTCCGACATCCTGCGC
AACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTC
CGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGG
CCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCC
CGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGA
GATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCG
GCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACC
AAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCG
CAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGC
GCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTC
CAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGC
CAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCA
CCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAAC
GGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAA
CATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCA
GGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATC
AAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAAC
CGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGT
CCGTTACAGACGACCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTC
GACTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCAAAGACGAC
GACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAG
CCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTC
AGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTC
CTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCT
TCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGAC
GAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAA
CTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTTACCG
GCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACG
CAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGG
CAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTC
CCCACATTTTGGACAGCAACCAGGAATGCACCCACACTGTCGACAGCAAC
AGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTT
CTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGC
TGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGC
TTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTC
CGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCG
CCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTAC
CAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGC
AGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGG
ACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAG
TACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGC
CGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGC
AGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTC
TCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCG
CCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGC
GGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTG
AAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTC
CCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCA
TGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACC
AACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTA
CATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGC
GCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCC
CACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTC
CGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGA
GGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAAC
ATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGT
GCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGT
TTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTC
GAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCA
CCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGG
AGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGC
TCGTACTACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAA
GGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGA
TGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATG
TTCCTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCG
GCTGGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGA
TGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGG
CAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTG
GAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAA
TGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCA
GTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGACACTGCACAGA
AAGCAACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATATG
ACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGT
TTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCT
CGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTC
TAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGA
CATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCC
GTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGT
CCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAG
ACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCG
CGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCG
ACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAG
CAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCACAC
TGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATC
TGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACG
CAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCT
GTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCG
ATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTG
TGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAG
CCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCG
TCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAG
AAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCG
CCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCG
ACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATG
ATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGC
CTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCG
ACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGG
AACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGT
GATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCG
CCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTC
CGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCG
CACCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCC
GTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTC
CAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTC
CTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCC
ACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTC
ACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTC
TGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCG
ACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTC
TTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCT
GAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAA
ACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAG
GAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAA
CCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGATGATGT
ACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAAC
GTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGAC
CAAGAGCACGATGTTCCTGGACTCCACCCACACCATTCCCACCAGCACCG
GTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCACCCACGTCAAG
GTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCAT
GCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACT
CCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGT
AGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGC
AGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCC
GACACTGCACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCTAC
AGGTACAGATATGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGA
CGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCT
CAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCA
TCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAG
AGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCC
CAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAA
CGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCAC
AGACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGC
CTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTC
CAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAA
CTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGG
AATGCACCCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGT
ACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCAC
CGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCA
AGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTC
CAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGAC
CCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCC
CGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAG
GAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCC
CGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACG
AGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACC
GGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCC
CACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGG
TCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGC
CAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGC
CGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGG
AGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAG
GCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAA
CCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCT
GCACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGAACAAGGAGGAG
GACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTC
CCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTT
CTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGC
CACGACGAGTTCCACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCT
GGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGG
GATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGAC
CTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCT
CACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCC
GTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGC
TACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCG
CTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACG
CTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGG
GACGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAA
GCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGG
ACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCACCCACACCATT
CCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCAC
CACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCA
GCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCC
ATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGC
CCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTAT
TCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGAC
GACCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTCGACTACAGAAT
AGGCCGCACCTACAGGTACAGATATGACGCAAAGACGACGACACAGCTGG
TCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGAC
CTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGA
TCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGA
GGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAG
GATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGT
GGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCA
GCCAGAGGCGCACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCGAT
GTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCG
CACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCG
GCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTG
GACAGCAACCAGGAATGCACCCACACTGTCGACAGCAACAGCCTCATCGA
GTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCC
AGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAG
AGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTC
CGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGC
GCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTG
CGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGA
CATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCT
GCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCC
CTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAA
GGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCT
TCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGT
GAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGAT
CCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCA
GGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCC
TTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGG
TAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCC
TGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTC
CGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTCAT
GAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCG
CGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGAC
TCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCA
GCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTCCGACATCCTGC
GCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCC
TCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGA
GGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCG
CCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTG
GAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTT
CGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGA
CCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCAC
CGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGT
GCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGACG
TCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTG
GCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTC
CACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCA
ACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGC
AACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCC
CAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAA
TCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGA
ACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATC
GTCCGTTACAGACGACCAATGTTCCCGACACTGCACAGAAAGCAACGTTC
TCGACTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCAAAGACG
ACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGC
AGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGC
TCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACG
TCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCG
CTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAG
ACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAG
AACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTTAC
CGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCA
CGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTC
GGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCG
TCCCCACATTTTGGACAGCAACCAGGAATGCACCCACACTGTCGACAGCA
ACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCC
TTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCA
GCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGG
GCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAG
TCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGAC
CGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGT
ACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGG
GCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCAT
GGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGG
AGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTG
GCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACT
GCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCC
TCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAG
CGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGA
GCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCC
TGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTG
TCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGC
CATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGA
CCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCC
TACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAA
GCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGT
CCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTG
TCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAA
GAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGA
ACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTC
GTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGA
GTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGG
TCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTG
CACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCT
GGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAG
GCTCGTACTACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTC
AAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGAT
GATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGA
TGTTCCTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTG
CGGCTGGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAA
GATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGG
GGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGG
TGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAA
AATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCT
CAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGACACTGCACA
GAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATA
TGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCG
GTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAG
CTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGC
TCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGA
GACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGT
CCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCT
GTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGG
AGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAG
CGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTC
CGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACA
AGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCAC
ACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCA
TCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCA
CGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTC
CTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTC
CGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACC
TGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTC
AGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTC
CGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGA
AGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCG
CGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGC
CGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGA
TGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCC
GCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTC
CGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGA
GGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAG
GTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGC
CGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGG
TCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGC
CGCACCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGT
CCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCT
TCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGT
TCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTT
CCACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGT
TCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTC
TCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTC
CGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGG
TCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGC
CTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGA
AAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGA
AGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAG
AACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGATGAT
GTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGA
ACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTG
ACCAAGAGCACGATGTTCCTGGACTCCACCCACACCATTCCCACCAGCAC
CGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCACCCACGTCA
AGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGC
ATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGA
CTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATT
GTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTG
GCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTC
CCGACACTGCACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCT
ACAGGTACAGATATGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGC
GACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCT
CTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAG
CATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAG
AGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGT
CCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCA
AACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGC
ACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGA
GCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCT
TCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCC
AACTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCA
GGAATGCACCCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGT
GTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCC
ACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCAC
CAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCT
TCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAG
ACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGAC
CCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGC
AGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGAC
CCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAA
CGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGA
CCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAAC
CCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGA
GGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACT
GCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTG
GCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAA
GGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGC
AGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCC
AACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCC
CTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGAACAAGGAGG
AGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCG
TCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTC
TTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGC
GCCACGACGAGTTCCACAACACCGTGTCCGACATCCTGCGCAACTCCGAG
CTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGA
GGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTG
ACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAAC
CTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGG
CCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAG
GCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAG
CGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAA
CGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACG
GGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAG
AAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCA
GGACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCACCCACACCA
TTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCC
ACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTT
CAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCC
CCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGAC
GCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCT
ATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAG
ACGACCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTCGACTACAGA
ATAGGCCGCACCTACAGGTACAGATATGACGCAAAGACGACGACACAGCT
GGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTG
ACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTG
GATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAA
GAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCC
AGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGG
GTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCT
CAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCG
ATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGG
CGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGAC
CGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTCCCCACATTT
TGGACAGCAACCAGGAATGCACCCACACTGTCGACAGCAACAGCCTCATC
GAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGG
CCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGC
AGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGC
TCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGG
GCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCG
TGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGC
GACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCAT
CTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCC
CCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATG
AAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGT
CTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGT
GTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTG
ATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGAT
CAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACT
CCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATC
GGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGT
CCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCT
TCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTC
ATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGC
CGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGG
ACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAG
CAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTCCGACATCCT
GCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCT
CCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGC
GAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAG
CGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGC
TGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTC
TTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAA
GACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCC
ACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTAC
GTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGA
CGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGC
TGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGGAC
TCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCAT
CAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGC
GCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATG
CCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAG
AATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCA
GAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTA
TCGTCCGTTACAGACGACCAATGTTCCCGACACTGCACAGAAAGCAACGT
TCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCAAAGA
CGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATC
GCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAG
GCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGA
CGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTC
CGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGA
AGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGC
AGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTT
ACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGAC
CACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCC
TCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAG
CGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCACACTGTCGACAG
CAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGC
CCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTG
CAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCT
GGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCC
AGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAG
ACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGT
GTACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCA
GGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCC
ATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAA
GGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGC
TGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAA
CTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTC
CCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCC
AGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGA
GAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTC
CCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGC
TGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCC
GCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCT
GACCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCG
CCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTC
AAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTG
GTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCG
TGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGAC
AAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTG
GAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCT
TCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCA
GAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCT
GGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCT
TGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAG
CTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGA
AGGCTCGTACTACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACT
TCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAG
ATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCAC
GATGTTCCTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCC
TGCGGCTGGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGC
AAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGA
GGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTC
GGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACA
AAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTT
CTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGACACTGCA
CAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGA
TATGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTC
CGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCG
AGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAG
GCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGA
GAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCT
GTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTG
CTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGA
GGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACG
AGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGC
TCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCA
CAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCC
ACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGT
CATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAG
CACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTC
TCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGAC
TCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGA
CCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGT
TCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGAGATGCGC
TCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGAT
GAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCG
CGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAG
GCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCA
GATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGT
CCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAG
TCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGA
GAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGA
AGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCC
GCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCC
GGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCA
GCCGCACCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGACAGCGAG
GTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTT
CTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTG
GTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAG
TTCCACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAA
GTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCT
TCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTC
TCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCAT
GGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGG
GCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCC
GAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCT
GAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGG
AGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGATG
ATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTG
GAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGG
TGACCAAGAGCACGATGTTCCTGGACTCCACCCACACCATTCCCACCAGC
ACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCACCCACGT
CAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCA
GCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAG
GACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGA
TTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAG
TGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGT
TCCCGACACTGCACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCAC
CTACAGGTACAGATATGACGCAAAGACGACGACACAGCTGGTCGGAAGCA
GCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTG
CTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGA
AGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCC
AGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATT
GTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACAT
CAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGC
GCACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTAC
GAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCAC
CTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGG
CCAACTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAAC
CAGGAATGCACCCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGAC
GTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCG
CCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGC
ACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCG
CTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGC
AGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAG
ACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGT
GCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCG
ACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCAT
AACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGT
GACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGA
ACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGT
GAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTA
CTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGC
TGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGAC
AAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGG
GCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACG
CCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTG
CCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGAACAAGGA
GGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCC
CGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAG
TCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAA
GCGCCACGACGAGTTCCACAACACCGTGTCCGACATCCTGCGCAACTCCG
AGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGG
GAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGC
TGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGA
ACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGC
GGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCA
AGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGA
AGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTC
AACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTA
CGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCAC
AGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAG
CAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCACCCACAC
CATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCG
CCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGC
TTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAG
CCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGG
ACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTC
CTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTAC
AGACGACCAATGTTCCCGACACTGCACAGAAAGCAACGTTCTCGACTACA
GAATAGGCCGCACCTACAGGTACAGATATGACGCAAAGACGACGACACAG
CTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGT
TGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACG
TGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAAC
AAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTT
CCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCT
GGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTAC
CTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACGTTACCGGCGCCTG
CGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACA
GGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAG
ACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCGAGCGTCCCCACAT
TTTGGACAGCAACCAGGAATGCACCCACACTGTCGACAGCAACAGCCTCA
TCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCAC
GGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCC
GCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCC
GCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGC
GGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGG
CGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGC
GCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGC
ATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGT
CCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCA
TGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAG
GTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCT
GTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGC
TGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAG
ATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCA
CTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGA
TCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGC
GTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGC
CTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCT
TCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAG
GCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCAT
GGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTC
AGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACACCGTGTCCGACATC
CTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTT
CTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCG
GCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGC
AGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACAT
GCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTT
TCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTG
AAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGT
CCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACT
ACGTGCGCATGTACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTT
GACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAA
GCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGG
ACTCCACCCACACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCC
ATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGT
GCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCA
TGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCATTCGGTGGAGACCC
AGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAACAAAAATGGAGCT
CAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGCTTCTCAGTGCCGC
TATCGTCCGTTACAGACGACCAATGTTCCCGACACTGCACAGAAAGCAAC
GTTCTCGACTACAGAATAGGCCGCACCTACAGGTACAGATATGACGCAAA
GACGACGACACAGCTGGTCGGAAGCAGCGACGAAACTTCCGGTTTGGAAA
TCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTGCGAGCTCGTCCTC
AGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCCAGGCTCTAATGGT
GACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTGGAGAGACATCCTC
TCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGATCTGTCCGTCTGCC
GAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTGTGCTGTCCGCGCT
GCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATGGAGGAGACCGACG
TTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGACGAGCGCGGCCTG
ACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGATGCTCCGACCGCCG
CCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTACCACAAGCAGACCG
AGCGTCCCCACATTTTGGACAGCAACCAGGAATGCACCCACACTGTCGAC
AGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGCGTCATCTGCTGAG
GCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGCAGCACGCAGAAAC
TGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTCTCTCCTGTCTGGT
CTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACGACTCCGATGACTC
CCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGGGACCTGTGCGCCC
AGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCTGTTCAGCCGCCTG
GTGTACCAGATGCGCGACATGAACGTGCAGGAGATGCGCTCCGTCATCGC
CAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAGATGAAGAAGTTCG
CCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTCCGCGCGCCTGGTG
AAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGCAGGCCGACGCCTG
GCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCGCAGATGATCGCCG
AACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCGGTCCGCCTACCTG
TCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCGAGTCCGACTGCGC
CCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTCGAGAGGAACCTGG
GAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGAGAAGGTGATGATG
TCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGTCCGCCGCCCCCAC
GCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATCCCGGTCCGCCGCG
CCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGTCAGCCGCACCGCC
CTGACCAACACCTTCATGAACAAGGAGGAGGACAGCGAGGTCCGTATCGC
CGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGACTTCTTCCAGATCG
TCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGTTGGTTCCTACGTG
TGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACGAGTTCCACAACAC
CGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAGAAGTTCACCGGAG
ACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGTCTTCTCTGACCGT
TGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCTTCTCCGACACGTC
CTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCCATGGTCTTCGGCG
CAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGAGGGCCTGAGCTAC
CTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCCCCGAAAACAACGT
CTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTCCTGAAGGAGAACA
AGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCAGGAGAACCAGCCC
GAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGATGATGTACGGCGA
CTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGCTGGAACGTCATGG
AGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGAGGTGACCAAGAGC
ACGATGTTCCTGGACTCCACCCACACCATTCCCACCAGCACCGGTCTGCC
CCTGCGGCTGGCCATCAACGGGACCGCCACCACCCACGTCAAGGTGTCCG
GCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCGCAGCATGCACATC
GAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGAAGGACTCCATCAT
TCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACGGATTGTAGCTCAA
CAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCTAGTGGCAGGAGGC
TTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAATGTTCCCGACACTG
CACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGCACCTACAGGTACA
GATATGACGCAAAGACGACGACACAGCTGGTCGGAAGCAGCGACGAAACT
TCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAGTGCTCTCAAAGTG
CGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAGGAAGCATCTCGCC
AGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTTCCAGAGAGCGCTG
GAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAATTGTCCCAGAGAT
CTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAACATCAAACGTGGTG
TGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAGGCGCACAGACATG
GAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGTACGAGCCTGTTGA
CGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGCACCTTCCAGCGAT
GCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCAGGCCAACTTCTAC
CACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCAACCAGGAATGCAC
CCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTGACGTGTACAGAGC
GTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGGCGCCACCGTGCGC
AGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCACGCACCAAGTCTTC
TCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTGCGCTTCCAGCACG
ACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGAGCAGACCCTGCGG
GACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCGAGACCCCGGCCCT
GTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAACGTGCAGGAGATGC
GCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAGCGACCCCGAGAAG
ATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCCATAACGAGGCCTC
CGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAGGTGACCGGCGAGC
AGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAAGAACCCCACCCCG
CAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCCGTGAGGTCCGCCG
GTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAGTACTGCCAGGCCG
AGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGCGCTGGCCGTCTTC
GAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCGACAAGGAGGAAGA
GAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCCGGGCAGGCCGTGT
CCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGACGCCAACCCCATC
CCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCCTGCCCTGCACCGT
CAGCCGCACCGCCCTGACCAACACCTTCATGAACAAGGAGGAGGACAGCG
AGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTGCCCGTCCCACGAC
TTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGGAGTCTTCTCAGGT
TGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAGAAGCGCCACGACG
AGTTCCACAACACCGTGTCCGACATCCTGCGCAACTCCGAGCTGGAGAAG
AAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCATGGGAGGGATCCGT
CTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAGGCTGACCTGATCT
TCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCTGAACCTCACGGCC
ATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGGGCGGCCGTATCGA
GGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCACCAAGGCTACTTCC
CCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGAGAAGCGCTCCGTC
CTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGTTCAACGCTAAGCA
GGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATGTACGGGGACGAGA
TGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGCACAGAAGCAGGGC
TGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGCAGCAGGACTATGA
GGTGACCAAGAGCACGATGTTCCTGGACTCCACCCACACCATTCCCACCA
GCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGACCGCCACCACCCAC
GTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGGGCTTCAGCCCGCG
CAGCATGCACATCGAGGGGCAGGTCATGCCCAGGAAAAGCCCCATCGCGA
AGGACTCCATCATTCGGTGGAGACCCAGAATCAAGAAGGACGCCCGAACG
GATTGTAGCTCAACAAAAATGGAGCTCAGAACCGTTGTCCTATTCGCCCT
AGTGGCAGGAGGCTTCTCAGTGCCGCTATCGTCCGTTACAGACGACCAAT
GTTCCCGACACTGCACAGAAAGCAACGTTCTCGACTACAGAATAGGCCGC
ACCTACAGGTACAGATATGACGCAAAGACGACGACACAGCTGGTCGGAAG
CAGCGACGAAACTTCCGGTTTGGAAATCGCAGCCACAGTTGACCTGGAAG
TGCTCTCAAAGTGCGAGCTCGTCCTCAGGCTCAGTGACGTGGATCTGAAG
GAAGCATCTCGCCAGGCTCTAATGGTGACGTCCTCCAACAAGAGGGAGTT
CCAGAGAGCGCTGGAGAGACATCCTCTCCGCTTCTCCTTCCAGGATGGAA
TTGTCCCAGAGATCTGTCCGTCTGCCGAAGACGAGCCCTGGGTGGTCAAC
ATCAAACGTGGTGTGCTGTCCGCGCTGCAGAACTCTTACCTCAGCCAGAG
GCGCACAGACATGGAGGAGACCGACGTTACCGGCGCCTGCGATGTGCAGT
ACGAGCCTGTTGACGAGCGCGGCCTGACCACGCAGTACAGGCGCACCCGC
ACCTTCCAGCGATGCTCCGACCGCCGCCTCGGCAGCGAGACCGGCATCCA
GGCCAACTTCTACCACAAGCAGACCGAGCGTCCCCACATTTTGGACAGCA
ACCAGGAATGCACCCACACTGTCGACAGCAACAGCCTCATCGAGTCTGTG
ACGTGTACAGAGCGTCATCTGCTGAGGCCCTTCTCTCACGGCCAGAACGG
CGCCACCGTGCGCAGCACGCAGAAACTGCAGCTGACCCCGCAGAGGCCAC
GCACCAAGTCTTCTCTCCTGTCTGGTCTGGGCTTCATCCGCTCCGACCTG
CGCTTCCAGCACGACTCCGATGACTCCCAGTCCGCCAGCGGGCGCGTGGA
GCAGACCCTGCGGGACCTGTGCGCCCAGACCGCCGAGGGCGTGCGCCCCG
AGACCCCGGCCCTGTTCAGCCGCCTGGTGTACCAGATGCGCGACATGAAC
GTGCAGGAGATGCGCTCCGTCATCGCCAGGGCAGAGGGCATCTGCAACAG
CGACCCCGAGAAGATGAAGAAGTTCGCCATGGACGCCGTCCCCCTGGTCC
ATAACGAGGCCTCCGCGCGCCTGGTGAAGGAGTACATCATGAAGGGCGAG
GTGACCGGCGAGCAGGCCGACGCCTGGCTGGCCGCCCAGGTCTTCGCCAA
GAACCCCACCCCGCAGATGATCGCCGAACTGCAGCCCCTGTGTGAGGGCC
GTGAGGTCCGCCGGTCCGCCTACCTGTCCCTCTCCGCGCTGATCCACAAG
TACTGCCAGGCCGAGTCCGACTGCGCCCAGCGCCCCGAGATCAGGAACGC
GCTGGCCGTCTTCGAGAGGAACCTGGGAGAGCGGTGCCACTCCTTCTCCG
ACAAGGAGGAAGAGAAGGTGATGATGTCCCTGAAGGCGATCGGTAACGCC
GGGCAGGCCGTGTCCGCCGCCCCCACGCTGTCCCAGTGCGTCCTGACCGA
CGCCAACCCCATCCCGGTCCGCCGCGCCGCCATGGAGGCCTTCCGCCGCC
TGCCCTGCACCGTCAGCCGCACCGCCCTGACCAACACCTTCATGAACAAG
GAGGAGGACAGCGAGGTCCGTATCGCCGCCTACATCCAGGCCGCGCTCTG
CCCGTCCCACGACTTCTTCCAGATCGTCAAGCGCGCCATGGACTCAGAGG
AGTCTTCTCAGGTTGGTTCCTACGTGTGGTCCCACCTTCAGCAGCTCCAG
AAGCGCCACGACGAGTTCCACAACACCGTGTCCGACATCCTGCGCAACTC
CGAGCTGGAGAAGAAGTTCACCGGAGACAAGAGGAAGTTCTCCTCCGCAT
GGGAGGGATCCGTCTTCTCTGACCGTTGGAACATGGGCGGCGAGGCCCAG
GCTGACCTGATCTTCTCCGACACGTCCTTCGTGCCCCGCAGCGCCCGCCT
GAACCTCACGGCCATGGTCTTCGGCGCAGAGTTTAACATGCTGGAGATGG
GCGGCCGTATCGAGGGCCTGAGCTACCTGGTCGAGTCTTTCTTCGGCCAC
CAAGGCTACTTCCCCGAAAACAACGTCTTGCACCTGCTGAAGACCAAGGA
GAAGCGCTCCGTCCTGAAGGAGAACAAGCTGGAGGAGGTCCACCGCAAGT
TCAACGCTAAGCAGGAGAACCAGCCCGAAGGCTCGTACTACGTGCGCATG
TACGGGGACGAGATGATGTACGGCGACTTCAAGGGGCTTGACGTCCAGGC
ACAGAAGCAGGGCTGGAACGTCATGGAGATGATGATGAAGCTGGCCAAGC
AGCAGGACTATGAGGTGACCAAGAGCACGATGTTCCTGGACTCCACCCAC
ACCATTCCCACCAGCACCGGTCTGCCCCTGCGGCTGGCCATCAACGGGAC
CGCCACCACCCACGTCAAGGTGTCCGGCAAGATGGACGTGCGCAACATGG
GCTTCAGCCCGCGCAGCATGCACATCGAGGGGCAGGTCATGCCCAGG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL97090gene:BL97090Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL97090_cuf33-E1BL97090_cuf33-E1-1564476830-20854Branchiostoma lanceolatumexon
BL97090_cuf33-E2BL97090_cuf33-E2-1564476830-20851Branchiostoma lanceolatumexon
BL97090_cuf33-E3BL97090_cuf33-E3-1564476830-20849Branchiostoma lanceolatumexon
BL97090_cuf33-E4BL97090_cuf33-E4-1564476830-20847Branchiostoma lanceolatumexon
BL97090_cuf33-E5BL97090_cuf33-E5-1564476830-20845Branchiostoma lanceolatumexon
BL97090_cuf33-E6BL97090_cuf33-E6-1564476830-20843Branchiostoma lanceolatumexon
BL97090_cuf33-E7BL97090_cuf33-E7-1564476830-20841Branchiostoma lanceolatumexon
BL97090_cuf33-E8BL97090_cuf33-E8-1564476830-20839Branchiostoma lanceolatumexon
BL97090_cuf33-E9BL97090_cuf33-E9-1564476830-20837Branchiostoma lanceolatumexon
BL97090_cuf33-E10BL97090_cuf33-E10-1564476830-20835Branchiostoma lanceolatumexon
BL97090_cuf33-E11BL97090_cuf33-E11-1564476830-20833Branchiostoma lanceolatumexon
BL97090_cuf33-E12BL97090_cuf33-E12-1564476830-20831Branchiostoma lanceolatumexon
BL97090_cuf33-E13BL97090_cuf33-E13-1564476830-20829Branchiostoma lanceolatumexon
BL97090_cuf33-E14BL97090_cuf33-E14-1564476830-20827Branchiostoma lanceolatumexon
BL97090_cuf33-E15BL97090_cuf33-E15-1564476830-20825Branchiostoma lanceolatumexon
BL97090_cuf33-E16BL97090_cuf33-E16-1564476830-20823Branchiostoma lanceolatumexon
BL97090_cuf33-E17BL97090_cuf33-E17-1564476830-20821Branchiostoma lanceolatumexon
BL97090_cuf33-E18BL97090_cuf33-E18-1564476830-20819Branchiostoma lanceolatumexon
BL97090_cuf33-E19BL97090_cuf33-E19-1564476830-20817Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL97090_cuf33transcript:BL97090_cuf33-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000001genomeSc0000001:1134070..1158082 -
Properties
Property NameValue
Transcript idBL97090_cuf33
Biotypeprotein_coding