Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96929_cuf0 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96929_cuf0
Unique Nametranscript:BL96929_cuf0
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96929_cuf0

>transcript:BL96929_cuf0-protein ID=transcript:BL96929_cuf0-protein|Name=transcript:BL96929_cuf0|organism=Branchiostoma lanceolatum|type=polypeptide|length=1917bp
GRLNVNVTEANGEDSSTIAFSWDAFKDGDVPTSVSSRAIGRYEWALTSST
ERKELLLPWAPIDIDSNDEERHEHTVSVPRHILATGCPKLVVRGFSKVGL
QSSVETDINDCSRSSIGPQHAVIDATGHIELEKNAVWTRDDADYTSSQSA
LAAVWPSLRHGQYVWAVIEESTGISDYGSVSGRSQFPYPCSHPLAISCGS
TTGEYVNVEDLALQHGRRYHICIHANRTTLVFETFSQELPAVSACSDGIT
VDHTPPSPGKVWIENSDGKTYQSSSSEIVVKWESFVDLEEHGTSHHVSGI
RTYLCAIGTSPGGIDVQEFTEVGNINSAIIHNLGLNSGVTYYATVKGVDF
VGLSSVAVSNGVTIDTTPPDKNDNAVDIGGLFLQSLDSISVSWSDVFFDK
ESGVTSFYWAVGSAPGVDDVVRLQPAENAMVEESAIDPPLLEGHTYYVTI
MAENGAGLVSTAISHGYVAETSPPEVGFVYDGPPTDPPNDLDYQSDKTTF
RAHWGGFHDPHTDIISYKWRIGTCPLCRDVLEEVDLGIKSDMSASNLPLV
PGFTYYVTVTACNAAQLCTTASSDGVLMDDTPPATGTVRDGAADMDLQYQ
PSAYLLRASWFGFHDAHSQLSHYEWRAGTSPGGSDILSPSQLHLAETALV
TMTTPMPADTKIYVTVKAYNKAGLWAEKSSDGFIIDATAPTVTTQTGIDL
SWGSLKADSQVIRTLLRVAWELADPDSGIDYHLLSVSTHQESRHNLPTVK
VSGNDQSYTFSDVTLHDGNSYSVTVVACNRAQLCTESTSSQIMVDGSPPT
VGTFAVGTDHVIDNQRPQSGWMTWQNNVNGNPTLLRLAWLGFTDVHSGIR
NYRVFVGTNFEADNLIPSGPVEVAPSGPALSTLEGVVHTAEIPVATVLSS
SSTVYIKIVAVNEAGLRGPASHEAFSLVASAADRGFLSLMRRCQAHSCQG
HCTCAPQDQLCTPTQSCNDITGGNPNTLIEVYDAIDLTDISSVSEENDVD
YTPAGDFLAAKWKVTRNSGLSVTRYEWSVGKKGQTVGSGVFDLLEDRIWQ
EANGANYGVIHLPVTQDGAHTLRGAEYVFYVRAWYSQTTYAVFSSDGVML
DITPPNVHSSIKVKDLMTTSATVDIDYTTQTATLVCGWDGVFYDTDSGIE
SFEVAIGLESNDDSISPYTDNKVSSATTTHQLDGLSLNEGIRYHCNVRAF
NKVLLYSTASSDGVTVDTIAPTAGVVMDGVVLHDVEYTNVSSSISASWHG
FWDSESFLHHYMWCLGTTTAAAECSVLAPTDVGLRTAARTQLDAALDSGV
KHFSKVYAVDNAGLQSNVARSDGVTIDTTPPVVLETLEVGQNIVEDFSFE
ESPSPIRVESGEALDLSSLPSFASSHWTVEDGSSAAVLNASAGDHGSNVL
YLAGSLSQQLTTTTGSKYRLTLSLLHNPFVQNKRSDEEVLIQAPGISKVV
QLYRRPGRHDSKNANRWQKVTIFFTATSASSSVSVATPGRTRGILVDNVD
VRLCNVMEAQEGMNSVHVELQIIHGLSSVFASWGFVDMESPIVDYMWAIG
TVQGGTQLQAFRSVGTSDQAINSDLTLTQGSNVYVTVVAVNSAGLRSVVH
SQPAMVDKTPPVISFVRDGSSDKDVDFQSDNVISANWDASDPESGISRIE
WAIGMEPGSSSISDYTVSEDPRSASKSVSGLSHGQTVYVTVRCHNNVGLY
STMSSDGVTIVTSPPSTAAAQLSVLTRSETHYPTRGNHQSQTDMLQLSWG
GFTDTTGIAAYQYTLEGPGSDNSTWYSLSPYGDTSTILGLDLQPDASYKV
FLRAINNVQMESASLQADVQIINSSPSVSGESNVTHSWEDDTNVVIDWEG
VFEAATDLVYEITIGTTLGGNDVQQWVETVETNIKVGPVDPTKHHFGTIT
AINPVGMYENVAFDFIR
Run BLAST on NCBI

mRNA from alignment at Sc0000014:2282670..2294219-

Legend: polypeptideexonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96929_cuf0 ID=transcript:BL96929_cuf0|Name=transcript:BL96929_cuf0|organism=Branchiostoma lanceolatum|type=mRNA|length=11550bp|location=Sequence derived from alignment at Sc0000014:2282670..2294219- (Branchiostoma lanceolatum)
GGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTAC AATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCG TGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACA GAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAA TGATGAGGTACGTGAAAAAAGTTGGTGACTACTACGTGTTAGCGAATGAA TGGGGAATATGCCAATTCTTTGACCTAAGAAAGGTCCTTCTCTACATTGG ATCTCCATGTCGATCTTGGCCTTCCTCTGCTTTTTCTTCCACCGAGTGGC TTCCAGTCAATGATGTTCTTCGCTGTCCTGTGTTTACAGTGATGGAATAA TTAGTATCTAACATTATAGCGCTCGTGTTCTTGTCGACAAACTTTATTGT TTCTCTCTCAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATC TTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGG TTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCA TCGGACCTCAACATGCTGTCATTGACGCTACAGGTGGGTTATGATTTGCC AGACCACACACAGTTGACACACCATCTTCAAAAACTGTTCCTTGTTAAAA CAAGTACACAGTCGCGTGCGTAGTAAACCAGTATTTCATCAGCGATTGAT ATGGTGAAATAATGCGCATGGTTCACATACAGGGCACATTGAGCTAGAAA AGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCT GCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGC GGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCA GAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGC AGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGG CAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTG AGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATC ACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTC TGACGGAAAGACTTACCAGGTACGCTCTATTCTTTATCATCAAATGTAGA GGATATGATGCTTTCTTGACGTTACCAAACAAAGGGATAGGGGCGTCAAT GATTTGAATCAGGACTTGAAAGATGTAATTGACGTATACAAATGATTTTG TCCTGCTGCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTT GTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGAC ATACCTGTGTGCCATCGGTGAGTAACCTCTTTTTTTATGCCAGCTAAAAC AGCTTTAAAAAGTGGCATTTGCACTAACAATTCTTAATCTTTTCATAATG TGCGGTAGTCATTAAAACTTCTGACCCCGACTTTTATACCCCGCAGGCAC CTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCA ACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTAT GCAACAGTCAAAGGTCTGCAACTTTTCACCTTATCGATTAAGGACAGGAC ATTAATGATAAGAAAGCAGCGTCCATACAAATCTTCGTAGGCTGTCACGT ATTTTTTTTTTATTATGTATCTTTTAAGTTCTGGTCACTTCCTCCTTAGG GTTCCGAGTAGTTGGTACTGATATGGATACAAAGATGAAAATAAATAAAT ATTCTGTGTCCTAAAGAAAGAAGTCGGACAACACAAAAGTAAAAGCCAGT GCAAATTTGTCGCAGCTGTAGCTGCTGCAAACCCAGAATTTGAGTTATCA GAATATAGTGGTAACACACCAATCAGTAACCATAACCCCCTCTTGTAAAT TAACAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGC GTGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATAT TGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGGTTTGTGA GTTTTCTTTTTGCCGTCTTTTTCCGCTTTGATTAATAGCATGGGGTGCTT TCCTACTTTCATTACCCTCAAAGTTGCACTAGTGCCTGTCTCCTTCCTTC ACACCATTGAAATATAGTTTTTATCAGTCGGGAAAGACTCTAGCACAAAA GACGAGCTTCCCGTGTTGCATCAAATACTAAAAAATTCCAGCCTTACACG AGGTATTTATAATGTATCAATCGATTCCTTTCATGTACAAAGCTGGTCCG ACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTT GGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAA TGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACA CTTACTATGTAACAATAATGGTCAGTAGTTTGTATTGTTTTTGTTTGCAT GTACAAGTTGACTAAGTCAATGTTGTCCCATTCGTTTCTAGTTTTGGCAT AGAAGTTTCTATTTTATAAACCTTTTCGGAATGTTTAAACTTTCCATATT TCTTCCCAAAGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCT CACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGA TGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGA CAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATC ATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCT AGAGGAGGTGGATCTTGGGATCAAATCAGGTATTTTTAGTCGATACGTCC ATTTTTTTTTGGATGGCAAATCCTAATCAAACTAGCATTCAGACATTTGT AGAAAAATAACATAAAAAGAAAACTATATTATTATACCAATTTGTATAGG GCAGGTGATTTTTCTTAAAAGAAACGATTTTCTTATAATTTTTTATATTT TTGATTACTATGTCTTCCAGACATGTCAGCATCCAATCTGCCGCTCGTTC CCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTG TGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGC TACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGC CATCTGCGTGAGTAGACATTTAGACCGATTGCAATAAAAATCCACTTGTA CAATTCATGATCAGGAGGGGCATTCGTTGCTAGACGCTAGCTTGCTCCAA TTGTTCTACTTAAATTGATCATAGGAAAAGTTCAATATAATGTCCAAAAT GTTTCAGATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCAT TCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAG CGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTA CCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAG GCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCAT CATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGA GCTGGGGCTCATTGAAGGCTGATTCACAGGTATGTTTCTATAAACCTTTT GAAGAGTTTGGTAAAGCTTGCATAGTCTTTCTGATTTCTGCCTACATATG ACGCAATATGTGATAGCCTTGTCACCATACGAAGCTGAATATTTCAGGTC ATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGG CATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATA ACCTCCCTACAGTAAAGGTGGGGCGTTTGTTTCCTTTGTTTTGTTTGTTT TGATGTTGAAGCCTCTGCTGTGGGGCATTAGAAATGTTTTTCCCATACAG ACAATCAAAGATGTTCGATCTTATTACCGTGGTGTGGCTGTACATGGCTC TATATACTTACCTGCAAGTGTATTAATGTAACTCTTTTGAATGGAATCAG TAATTTATTTACAATTTGATGTGTTTCATCGATCTAAAACGTGCTTGCTT CACCCTTATACAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACG TCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAAC AGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTTGGTTT ACATCGTCGTTTATAGAATTGCTAAATAGATAGAAGTTACAGTATTCAAA TCAAGCAACATTGTCAATGTAGTCACATCGATACATGCCTTGATGGAATT GTTGTGTTCATCTGATTTAGACTCGCTAATTCTTGAGATTAATGTTTTGC CTTAGGAGAGGAGTTTGATACTTTAATGTACACTTATGTTAGGTGGACGG CTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAG ATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAAC GGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCA TTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAG ACAACCTGATTCCAGTAAGTATTGAAGTGGAATTTGTAAAAAAAAATTGA CATGTTAGTAATATACAGAATACAACGATTTCTATCTCTAAGATCTTAAA GTGATAGTGTGGAGCAAACAGTATACCCCATGGCCCATGGATGAATGCCT TGCGTCAAATTGAAATCCCATAGAAACGTTTGATGTTTGGGCAATTTTAT GGATACAAATATTATTACCATGACATTCTTGTGCGGTTTTGACCACATTA TTACCACCGGAAACAGAACAGTAATTTCATTAACGATTAAATCTATGAAC TGCAGTCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACC TTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAG CAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGTACAGT GATCAGTCAATTCTTCCTCATGAAATAAACAAAAATGAGGTAGTGTTTTC TTGATAGCAGTTGCAACAAAGCTGATGTTTTCATCAGAGTCTCAAGGTTC ATACCTGTAATTTTTGTTTGTTGTTGTTCTTTTGAAGGCTGGACTGAGAG GACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGG GGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACA CTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTA ACGACATAACTGGAGGTAACTTGTGTATGATTAAATGTCTATGGACCAAA ATAGAGCCTTGTCAATACTCTGAACCTTTGCTTTTGATCTCCATTTCTTT TTGAAGTACTTAAGTGTGCATCAGGTACCAATCAACATTCCATAAACTCC TCCAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGA CGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCT GGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTC AGTTACGAGGTACTTAAAATTTACTCAAGTAACTAACTAACCAACTCGAG TACACTTTATCTGCTGCTACATACAGGCAAGGAAACGCCAGGTTTCACCA ACAAGCTTTAAAAACTCGTAGAAATCTGTCTTTTCGTGCAGTGACTGCAA CAAAGTATGTGACTGTTTTTATGTCCACAGATACGAGTGGAGTGTAGGAA AAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGA ATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGT TACACAAGATGGGGGTAAGTACATCTCTGTAATCAAATGTCTACTCGTCA TCTTATGGTCTAATCTTCCTTGTCAGCATTTTTGTGAGCCTAGACGAAAA TAATCCATATGAAATATTACTGTCTGAACCTTGCGTTTTTTCTACATTTA CACAGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCAT GGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTA GACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTACGATATATAAA ATTGAATAAAGGGGCTTCGCAACATATGATCAACAATATCTAAATACATG TTAACACAACCTATATACTGCTACTGCTGAAATTGGTGGATGCATATGTA TTTGCCACTAGTTCCTAGACCGTTAGACCTAGTATAGACCATATAGAATA TTCGTCGATGAAGGTTACACATCAAGGGAGTAAAATACGCAAGATCACAG TTACTCAAGGCGCTAAAGTATCCAGTTGCTTGAGTAACTCTTATCTTGCG CAAACAGACCCCTGAGTAATAACACTATCTTTACAAGTTTGGAAATATCA GATTCAAGCCTTCATGATTCATTCGCAAATGTGATTTTCAATTCCGACCA ACTGTATAAAATGTTTACCGTTATTGTTTTGGTCTTTAGGTCAAAGACTT GATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGA CGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATC GAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGGTAAATATAAAAG TGAAACTAGGATACTTAAATAATTGATGCACATTATGTTGAAATGTGCGT GCAAAACACACCGACTTCACTGTAGTTATTGGATGCAAGCAGTTATCACT AGAAAAATATAAACAATCGAATGATCCAAGCGCAACATGTTATAAAGGAT TATTGATATTCTTCAGACGATTCTATCTCACCGTACACGGACAATAAGGT CAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGG GAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTAC AGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGC AGGTGTCGTCATGGACGGAGTCGGTATGTTTCTTCTACCATGATTTTGAC TTATACAATTTCTATGTATCAATTGCACTTCTAAGCTTAAGATTGGTTAT ATGTCATAGTGACAATGATTTCAAGGACGTGGATGTGCAGCATGAAGAGT TTTAATTTAGCCACGGTTGACCGACTAATTTCGCTAATAATGAGTTCTGT CGTTCTTTCGTAACAGTTCTTCACGATGTTGAGTACACAAATGTGTCCTC GTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTC ACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCG GTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCT TGACGCGGCACTAGATTCTGGTAGGAGTTACATTATTGTTTGAAACTCGA ATATGGGCTTCAATGTTTTAGTAATGAACCAATTGACGTATCATAAATGA GACATTGTGCTTGTCATGTATCAGTGCATCTTGCAAAAACTTGCATGGAT ACTATACTTTAATACATTTTACATTTACATTTTGCCAGGTGTGAAGCACT TCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCA AGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAAC GTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGC CAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTA CCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGC GGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTG CAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGA CTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGA TGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGT ACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAA GTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGC GACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGC TGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAA CTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGT GGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGTATGTCCA CTACTTCACTATTGTCATTGCAGTATCAGATATCTAGTCCCCGAATGTTA CATGTGTGACGGGTTACATGAAGTGCATCACTATTTACAAACCCGGATGT GTTCTATATGTAATAGCTTGTTTTATACAGCTAGTGACAAAACGTACATT TTTGTCAACAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCT CTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAA GGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCG CAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCA TATCTTTCGTTCGGGATGGATCCAGTGACAAGGGTAGGTGCAATGTCACT GTCGCGTATATCAATGATCAAATCAAATCATGTCAGTTTCTTTGACACTT CAATGAATAGATAAAGTGAATGACTAGCGTTCTTTCTTCTATTCCAGATG TCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGAT CCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGTACATGATACCT TTTAGTACAGAATATCAATACTTTCATCATTTCATTAACAGTGTTTGTTT ACATTCTTTTTGTGAATTCATTATAAGGCCTTATTTCGTTCTACGTTGCT ATGAAGAATTGTGATGGCAACGCTTTGTTTGGAAGTTAGATTGTCGTTAC CTAGTTTGCACCTTGAGTCCTTCAATGGACACAACTGATGACGAATTAAT CAATTTTCACGTCTCTTGATCTCCTACCACAGGCATGGAGCCCGGTTCGT CTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAG TCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATG CCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCA TAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACT CGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGA CATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAG CTTACCAGGTATGAGGCTTTGAAGATGTGAAAATATAGTACCCTATGCTT CTCTACACCTTCGGAATCTGGTACAGAATTCGACACTGTAGTAAACTTAT GTTGTCACAGTTCAGATGAAAGTAGATCTTGTAAATGTGTTGATACTTCA CCAAATACATGTCTCAATCCATGCAGTATACCCTAGAGGGACCGGGTTCA GATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTAT ATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCG CCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAG ATCATCAATAGTAGCCCGTCTGTGTCAGGTATTACAGCTTTTGTACAATA ATTCAGTGATGTATAAACAACTTATCTTCAACTCAACAATCAAAGCCACC ACGTGTTCTTTATCCAGGCATTTGTGGTACAGCCAAAGTTTACCATGCTC GTTTAACGCATTGTGGATGTAAGACTATCACAGGTTTGGTATGTAAATGT ATAAAGAATACAATATGCACGTTTGCTATATTTTATTGATACCGTGCCGT AAATACCCCATCTGACGTTCAAATTGTTTTTCAGGGGAGTCTAATGTGAC CCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCT TCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTC GGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAA AGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCA TCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAA ACAAGCATATCAAGAGCACCACTCACATTTATGAGAAGGAATACACAGAT AATTACCACGATTTTGATAAGTCTCCTGAAGTTTGTTGTACATGTATATG GCGATAGATAATAGCGCGCTGCATGTACATGTAAAAGACAATAAGCTTAT AATTCATAAATGAGGGTATACGTTATTACTGACTGATACATATAGATTAT ATGTACAACCGATTGGGACTTAGGCCTTGCTTGTACGTAATATGTACAAA GACTGTCCATATAGAATTGCATAGTAAATAGTGAATATATCACTAGAAAT TATTGATAGATTTTGCAGCATTATCTGACAAGTATACAATAGTATTGTAC AAGTCTTGGTGGGGAAAATCCTTGGATCTTGCTGTTTGAAATACTAATAT TGATAACTAGAGGAACTTGCAAAGGACCGTTTTTAGCCCTCAGTTCACAG TACAGGCGTTAAGCAGCAAAAAGGTATATAGGTTACAATATAATGAAATT TCACAACGCTGCAAGGTTTTGATTCATATGTACAAAACAGAACACACAAT TCTGCTACACCAAGCTTTACGCATCTTACATACGTGTACAAGGAGTTAGA ATTCGTGGACACTTTTGATTTTAAAGAATATTGTAAGATGTGCAATATTG TGCAGATAGATGTACTTTTTAGACTGGTGAAGTTGCAATAAAGCATAGAG

Coding sequence (CDS) from alignment at Sc0000014:2282670..2294219-

>transcript:BL96929_cuf0 ID=transcript:BL96929_cuf0|Name=transcript:BL96929_cuf0|organism=Branchiostoma lanceolatum|type=CDS|length=155358bp|location=Sequence derived from alignment at Sc0000014:2282670..2294219- (Branchiostoma lanceolatum)
GGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTAC
AATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCG
TGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACA
GAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAA
TGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAG
CTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTA
CAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGG
ACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGA
ATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCG
CTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGT
CATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAA
GCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGC
ACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAG
ACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGA
CGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACT
GTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGA
CGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGT
CGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATC
AGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCA
AGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGG
GTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTC
GTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAAC
ACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTC
AATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAA
GAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGT
GGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAAT
CAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATA
ATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTA
CGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCC
CCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTC
CGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTA
CAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGG
TGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTT
CCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACT
GTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTG
CTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAG
CCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCA
TTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCA
GCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTT
ACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAA
GGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCA
TCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTG
AGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAG
AGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCC
TGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAG
GTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGA
TGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCT
GCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACA
GTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCC
TCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACAC
TTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGG
AATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCC
ATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGG
AAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGT
TCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAG
AGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACA
GGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGA
CACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTG
TAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATG
CCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGAT
TACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAA
TTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTC
AAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAG
GAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGA
TGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCAT
GGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTA
GACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGAT
GACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGC
TTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAG
AGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACC
GTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATG
GTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTC
AACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGA
CACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACG
ATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGC
TTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAAC
CACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGAC
TTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTG
AAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAA
TGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGT
TGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAA
GAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAG
TTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAA
GCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTG
TATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAA
GTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGC
GGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTT
CAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTG
GCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTT
CTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGAC
GTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCA
TGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGG
GATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGC
ACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAG
TGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCT
ACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCAT
TCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCG
GGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTT
CCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAG
TGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGT
GTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACG
GACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTAC
TCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCAC
GGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAA
CACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGT
GGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGG
ACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACA
CGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTG
TTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGC
TGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATG
TGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGA
GTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAAC
CCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACA
TCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACT
GCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCG
TTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTT
CTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACA
TCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAG
TACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACA
GCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATC
TTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGG
TTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCA
TCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAA
AAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTC
TGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGG
CGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGC
AGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGG
CAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATG
GCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTT
GAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCAT
CACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATT
CTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGG
GAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGG
CATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATG
TTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAAC
CTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGA
CTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATA
CAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTT
CTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGA
CAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTG
GGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAA
GAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAAC
AATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACG
GCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGA
CCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAAC
CTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAA
GTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAG
GAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCT
CGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCC
AACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCT
CCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATA
TCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACG
CCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGA
GGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATT
AGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTG
TCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGT
TTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGA
CCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTC
TAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCAT
CTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGT
AAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGC
ATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAG
CTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCC
AACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGC
GTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCT
ACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGAT
CAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGA
TTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACC
TTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAG
CAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGAC
TGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCC
GACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCA
AGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAAT
CCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTAT
GATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGT
CGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAA
GAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAG
GGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATG
GCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACAC
AAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGA
GCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCAT
GTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACT
TGATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCG
ACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCAT
CGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCT
CACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTG
GATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGC
ATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCG
TGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTT
CACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCA
CGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGG
GAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTA
GGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGG
TGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGT
CAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTT
GTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATT
CGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACT
TAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGC
TCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGT
CCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCA
GCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAAC
AAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGT
TGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACC
GGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCT
GTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGT
TGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCG
TCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGC
TGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTAT
AGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGA
CCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAAC
GTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGT
GCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCG
TTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTC
ATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGAT
CGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACA
CAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCC
CACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCT
GTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCA
GCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTAT
CCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATG
GGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAG
AGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGA
GACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAA
GGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCC
AGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCT
AATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGA
AGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGA
CAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACT
AACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCAT
CACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCA
TTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGAT
TCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCC
CACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACAT
CCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATC
GACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACA
TATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAG
TGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGC
AGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCT
AGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCAC
AGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTA
TGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTC
TGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCT
GTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAG
CATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGT
GTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACG
GCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAG
AATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAA
GTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTAT
CCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATA
GATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCA
CAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAG
TTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATC
GATACAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCT
ATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCT
TCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCT
CCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGT
TGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATG
TAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCT
CACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGA
TGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGA
CAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATC
ATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCT
AGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGC
CGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCT
GCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACAC
GCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCC
AATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCAT
GACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCC
TGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGG
CATTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTG
ACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGA
TGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAA
TTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACA
CTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTA
TCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTA
CAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACA
CTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGC
ACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCAC
CTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAAT
CAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAA
TCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTG
GGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAAC
CTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTC
AACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGC
TGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCT
GGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGC
CGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCT
GCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACA
CAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGT
TTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACG
ACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTC
ACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAA
AAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAA
TATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTT
ACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGT
CCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGG
TCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAA
GACTTGATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAAC
TGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCG
GCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCT
ATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCA
ACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCC
GTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTG
ACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGT
TCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCAT
GGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGC
CTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGA
TGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATT
CTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTG
CAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCC
AGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCT
CATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTG
GACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGA
CGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCA
ATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACA
GGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACA
GAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCA
AGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCG
AACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTC
CTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACA
ATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAAC
AGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGC
CAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGG
CTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTT
GGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATC
AAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTG
TGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCT
TTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAA
CGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCA
GGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGAT
TACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCT
CTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGG
GTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCA
CCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACA
CTATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGT
CATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACC
CTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTA
TGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCT
ACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCA
CTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGA
GTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACT
GGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATT
GGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGA
GACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAA
CCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGAC
TTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGA
GGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATG
TGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTG
ACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGA
TATCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCC
GACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGC
AAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAG
AAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTG
AGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCA
TCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTA
CGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTG
TGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATA
TCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACT
CCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACAC
TAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGT
GACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGAT
CGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTG
TAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCAT
GTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGG
TATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTA
TCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAA
GGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGAC
CATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAG
GTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTG
TTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTC
CGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTA
TGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTAC
TATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCAT
TTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGT
ATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGAC
AAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGA
CATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATG
TCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAAT
CTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAA
TGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACG
ACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGAT
CTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTT
CCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACAT
CGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAA
ACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTA
CGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTT
CAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACT
GGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAG
GACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAG
ATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTC
CCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGT
CACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACA
GGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGC
TCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGA
TAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACG
GCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCAT
TCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGA
CAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTT
TGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACA
GTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGA
GGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCAT
CCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCAC
TCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACC
AACACAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAG
AAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAG
AACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAA
AGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAG
GAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGAC
AGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACC
CGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTT
ACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGAC
GGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGT
CAAAGACTTGATGACTACATCTGCCACCGTAGACATTGACTACACCACTC
AAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGAC
AGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGA
TTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGC
ACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAAC
GTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGG
TGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAG
TCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCT
TCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTG
GTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTA
CAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTA
GATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGG
TTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACAC
CCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGAT
TTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGC
GCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTG
AAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGG
AGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAAC
CACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCG
TACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATC
AGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAA
CGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGT
CGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTG
GACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAAT
GAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGT
TCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATG
TGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTC
TGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAG
GATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGC
AGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCAT
ATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTG
ACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATC
AGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAG
TGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTG
GTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAAC
GTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAG
CCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGA
CACACTATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAG
TTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTA
TACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTC
CCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCC
AGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGC
GTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAG
GGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATA
GACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCAC
CATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCG
TGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTC
GGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTT
TGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATG
GAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGA
GATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGC
ACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGA
TAGATATCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTT
CCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTT
CAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCA
GTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCAC
ATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACAC
ATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGAC
AGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGT
AGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGC
TATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGG
CACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACG
ACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATG
TAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTT
GGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATC
GTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCA
CCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAG
GAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCC
ATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGT
CAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCG
TGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATATT
GGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGA
CGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTG
GGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAAT
GCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACAC
TTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCG
CCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTT
GTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTC
TGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACA
CAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGA
GATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATC
CAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGT
GTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATG
GACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACAT
GGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTG
GTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGA
ACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGC
AGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGA
TCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAA
AGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACACA
GACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCA
TCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGC
ATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAA
CCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTG
ACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGT
AACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGA
CGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCA
TAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTC
AACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGT
GCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAG
CAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCA
GCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGC
CACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCA
ATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTT
GCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGC
CCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTA
CACCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTG
ATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGA
AGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGT
GGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGT
GTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGA
GGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATC
TACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTG
TTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTC
TGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAA
AGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTGACTACACC
ACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACAC
CGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATG
ACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACA
ACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTG
CAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAG
ACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGAC
GGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTC
TGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACA
TGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCG
CCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGC
ACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATG
CCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACG
ACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGA
AGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAG
AAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACC
GTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCA
CGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTA
CAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCC
TTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGG
GATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAA
AGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGC
GCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCT
CGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAG
GAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCA
GTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTA
CATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCC
GCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACC
CAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACT
TCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAG
TCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAA
AGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGG
AATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAA
TCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTG
AGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAA
CAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGA
CGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCA
GAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCT
GCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACC
AGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTG
AGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGA
CGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGA
GTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTG
TCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGT
GATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGA
TCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAG
ACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCA
CTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAG
CCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCC
AATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGA
CGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAAT
GGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCT
CCGATAGATATCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAG
CGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTG
GCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGAC
TGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGG
GCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACT
ACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACAT
GGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTA
CGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCC
TCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGAT
CTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAG
AACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTG
CATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAA
GTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGA
GATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACAT
CTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCT
CCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAG
TGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAA
CAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAAT
GGCGTGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGA
TATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGT
CCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCA
GTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGA
GAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCC
ACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGC
ACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGG
TTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACC
AGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCT
CACACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTG
CCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAG
CATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACA
GCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCT
GATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTG
ACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGG
TTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGC
GGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATC
TGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACACC
AAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGA
AAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTA
CACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAG
GTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTC
TGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTC
ATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTC
AGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGC
CTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGG
TGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCAC
GTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAA
CGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCG
ATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTT
GAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGG
ACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTG
TTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCC
GTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCT
TGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCC
AGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTG
TGTACACCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAAATAC
GCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTAT
CTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCC
AAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTG
GAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTT
TGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATC
CATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATA
TGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTT
CTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCA
ATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTGACTA
CACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATG
ACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCG
AATGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAAC
AACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATC
ACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCG
TCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCAT
GGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCA
TCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCAC
TACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATT
GGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACG
CGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGAC
AATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGA
CACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTG
TAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCG
GGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTG
GACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAG
ATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTT
ACTACAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAA
CCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTC
CTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGAT
TCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAAC
GAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAA
TCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAG
GAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTC
TTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTG
ACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCT
TTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCT
AACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTG
GACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCT
CCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTT
CCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAA
GCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCT
TCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTC
GGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCC
ACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATA
GTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCG
CTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGACA
TGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCT
TACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAG
TCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGC
CAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATG
GAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTC
TGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACG
TAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTAC
GAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGT
GGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGC
ACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAAC
GTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGA
GGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTA
AGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATAC
GAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATG
GGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGAACACACGG
TCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTC
CGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAA
TGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTA
CAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCG
GACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCG
ACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTG
ACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACAT
CCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGA
AGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGA
ACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTC
TCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGG
AAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCT
CGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGA
ACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCAC
CTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCA
ACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTAT
GCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTC
AAATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGG
TTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGC
TGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTG
GGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCG
CAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAA
GGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGT
CAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGG
TTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGAC
TACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGA
TCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCAC
TGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATG
TCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGT
TACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAG
TTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCC
GCTGACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAG
TTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGC
GTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTT
CATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGA
CACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGG
CAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTG
ACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTC
ACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCG
ACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCT
CGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACAC
ATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGG
TCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATC
ATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGA
CCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAA
ACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTC
ACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAA
CTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCA
GCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATT
CCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGT
TGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTT
CCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGA
TGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCA
ACTGTGTACACCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAA
ATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCG
GTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGC
TGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACG
AGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGAT
CTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGT
CATCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAG
AATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTC
TTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAG
CTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTG
ACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTC
TATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGA
ATCGAATGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCG
CAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGA
TATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGC
CTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCG
TCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCG
TCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCA
CCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGG
TATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTT
GACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGT
CGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCA
TCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAAC
ATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGA
GTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCAC
ACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCG
GGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCA
GCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCC
ACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAA
GCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACA
TGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAG
CAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGG
GGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGC
CCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCC
TGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATC
GTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCA
GGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGA
CCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCA
GCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAAC
GCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCG
ACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCG
GAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTC
GTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGA
AGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGA
TGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCAC
CATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGA
CTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACG
GACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGC
AGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGT
ACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTT
CAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCA
AATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCC
CGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACG
AACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGT
GTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGT
GGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACT
AAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGA
AAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGA
CAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCT
TTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCG
ATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGC
CATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGAACAC
ACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGT
TGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACA
TCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGAC
GCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGA
CGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTC
TGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATC
AGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTC
ACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACG
TCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCAC
GCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGC
AGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTC
CGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCG
TCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACA
CGGAACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCG
GCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAAC
ATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATA
CTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTG
TCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGACAAC
GCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGT
TAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCT
ACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAA
CCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCT
GGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCC
TTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCT
GAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCT
GGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCC
ATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGC
CCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGA
CATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGA
CGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGAT
GGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGG
AGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAG
CCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAG
TGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACA
ACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCG
CAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTG
TGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAAC
AGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTG
ATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGAC
CCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGA
ATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCT
ACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACA
GTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCA
GATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAA
CGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGG
CAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGG
CTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAA
CCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCC
CCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGA
GATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGA
TCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCT
TTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAG
AAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGG
ACCAACTGTGTACACCAACACAATCCTGTAACGACATAACTGGAGGAAAT
CCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTC
CTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCC
TGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGA
TACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTT
TGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACG
GTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGA
GCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGC
AGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTC
ACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGAC
ATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGT
GTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGC
TAGAATCGAATGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGC
AGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAAT
AAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTA
CAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGT
GTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTC
CTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTC
TTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGC
TCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCA
GCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACG
CTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTG
ACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACA
GAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCG
TGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCA
TCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTC
TGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCAC
AGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTATCACTC
CTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGAT
ACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTC
GACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTC
ACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAAC
GAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGG
AGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCAT
GGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCC
CATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAAC
TGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGAC
TTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAA
CTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACA
AAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGAT
GTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGA
TCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCG
GTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCT
TCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGT
GAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCG
TCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTG
CTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACA
AACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCA
TAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACT
TGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGA
TCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATG
TCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGT
AGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGA
CACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACC
TTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAA
CAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCC
TACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGT
ATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAAT
GTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGA
CGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTG
GTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTA
TTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGA
ACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGC
TGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACT
GACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCAT
TGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAG
ACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCG
AGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGG
CATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGT
GTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTC
AACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTAT
CCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTAC
CGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCA
AGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTC
ATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAG
AACACGGAACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCC
ATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGG
GAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTA
CATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTT
GCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGA
CAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCA
GTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCG
TTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTT
ACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTT
TGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCT
GGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCC
ACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACG
ACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGA
TTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAAC
ATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAAT
CAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTAC
GTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTC
TGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCG
ATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCTACTG
CGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTA
CGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTT
CACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATG
CCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGG
GTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCAC
CAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAG
GCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGC
TGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATC
AAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAG
AGCTACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGT
GACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAA
GCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTA
GGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGAC
GTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGC
TGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTG
GGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGT
TGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCG
CGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATC
AAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGA
AGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGA
TGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCT
CAGGACCAACTGTGTACACCAACACAATCCTGTAACGACATAACTGGAGG
AAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACA
TCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGAC
TTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTAC
GAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTG
TGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAAC
TACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCG
TGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGT
ACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAAT
GTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGT
AGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATG
GTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATT
GGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGGACAATAAGGT
CAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGG
GAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTAC
AGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGC
AGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATG
TGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCG
TTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGA
GTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGA
CTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTG
TACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGG
AGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCG
GACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATA
CGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGC
GTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACG
CGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTC
TCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTATC
ACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCC
TGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCT
GGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTT
CTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAA
GAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTC
ATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCAT
CCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGA
GTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACC
CAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAG
TGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGG
TCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTG
GACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAA
GGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTT
CAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAG
CCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAG
TGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCA
CCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGAC
GGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAG
TGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGT
CACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACA
GGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTC
AACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCC
TTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAAC
AATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAA
TAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGG
ATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACA
GACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGT
GCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGG
ATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGG
ATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGT
CAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCT
GGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCG
ATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACT
GCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCC
ATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCA
AAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGA
AACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTG
TCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACC
CGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTG
GCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTA
CAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATAT
CCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTA
CGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCT
GTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAG
CTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCC
GCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACC
AGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTA
GAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGACATACCTGTG
TGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGG
TGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGA
GTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTC
CGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGA
ACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCC
ATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTAC
CTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGC
GTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCT
CCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGG
AGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGT
CCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCA
AACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGG
AGGATTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCG
GAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATC
AAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTA
CTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTT
CTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTG
CGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCT
ACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTC
ACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCT
CCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACC
CATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAG
CAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACC
GCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATT
GAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAAC
TTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACT
CATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGA
CCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACT
CGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACA
TCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGC
AGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGA
TGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCA
TGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTT
CGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAG
AGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCAT
ACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTA
CATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCC
ACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCC
CTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGC
ACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGACATAACTG
GAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACG
GACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGG
GGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAG
TTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGC
GGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGC
CAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACACAT
TGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACA
ACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCC
TAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCA
CCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGG
GATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGC
TATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGGACAATA
AGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAAT
GAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCT
GTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAA
CGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACA
AATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGA
GTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAG
CAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCA
AGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAA
AGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTG
ACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAG
GTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCC
AATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTT
TCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTA
AACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTC
CCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACAT
TATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAA
GTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCG
ACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGA
TCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCG
GGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAA
CGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGA
TCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATG
GAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGG
AACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCA
ACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTG
GCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCAT
GGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTG
ACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGAT
GCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCAT
GGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCA
GGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTAC
GTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTC
CGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGC
TAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACCAC
CAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACAC
GACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATA
ACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTG
GGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCAT
CAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCA
TCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGG
GAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGC
AACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATG
ACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCG
GTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGT
CGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGA
ATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTT
AGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCG
AGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAG
AACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAA
CGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTG
CCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAG
TTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACAT
GCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATG
GACCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCG
TGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAG
TCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCC
ATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCG
AGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCAC
ATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCA
GGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACA
CGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACT
TACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGA
CCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGACATACC
TGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACA
GAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAG
TGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGT
CGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGAC
AAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGA
TTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGG
TTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTG
GTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGA
TCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGA
ATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAG
ACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCC
TCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATT
GGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGA
ATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGG
GATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTA
CGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACC
GCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGAC
TGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCAT
ATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTC
TCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTT
ATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAA
CACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAAC
AAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGC
AACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCT
CATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGG
GAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATC
CACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAA
ATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAACAGC
TACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATC
TACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGT
TCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGA
TGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTT
AGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAG
TTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCT
GTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGT
TCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAG
TCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCT
TCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCT
ATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACAT
GCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGACATA
ACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCT
GACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTG
CTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTT
TCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGG
CAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACG
GTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCAC
ACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACA
AACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACAC
CTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCT
GCCACCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGG
CTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAG
TTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGGAC
AATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCT
GAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTAC
TGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCG
CCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTA
CACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACT
CGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCT
GCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGC
TGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCT
CGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGG
TCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTT
GGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAA
GCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCT
TCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGT
TCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAG
GTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTC
ACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGA
AGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACC
GCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTT
ACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGAC
GCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGT
GCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTT
CAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGA
CATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAG
GAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCA
ATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGT
CGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAG
CCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCC
AGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTG
GGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAG
GCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGAC
CCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGT
CTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGT
CGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCA
CAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAA
CCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTG
ACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCA
GATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTAT
ATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCG
CCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAG
ATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAG
TTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGG
CAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGA
AATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGG
ACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACC
CAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGC
CTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGC
GTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGA
GCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGA
AAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGA
GGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCG
GCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCT
TCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCA
ACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCG
TATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCG
GCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGA
GGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGT
TCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACT
GGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTA
TCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTA
GCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGAC
CACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAA
GACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTG
TGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGACA
TACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATT
CACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTA
ACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGA
CTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCC
TGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCAC
TGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGC
GGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGA
CGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGA
TAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCG
GAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGC
TGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGG
ACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCA
CATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTACAAGTG
GAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATC
TTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGT
TTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCAC
TACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAG
GGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCT
GCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCA
GCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATA
TCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATG
ACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTA
CAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTG
ATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGG
GGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGC
CTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTG
TATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGC
GGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAA
CAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAG
AATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGC
ACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAG
CGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTC
GCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTAT
CGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGG
ACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAG
TGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCA
ACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACC
TGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTT
TTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGC
ACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGA
CATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCG
ACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACT
CCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGG
CCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCG
TGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCA
AACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGC
TCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACT
CACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATT
ACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTAC
ATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTT
GCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTT
GAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACAC
GGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTAT
CTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAG
GTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGAT
AGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTG
AGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGG
GACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTAC
GGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAA
CCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCAC
TTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGC
AAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAA
CGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCG
CCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACT
ACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTG
CGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTT
GCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAG
ACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAG
ATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTG
TACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAA
AGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAG
CGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGG
CTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGA
ACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTG
TGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTA
CAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCA
AGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCA
CTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAA
CCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGG
ATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAA
ACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCA
ATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGA
AGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAA
CAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACC
ATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGC
AGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAG
GCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTC
ACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGG
TTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTA
CTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTC
CGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGT
CCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCC
ACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTC
GAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGG
CGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAG
TAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATC
AACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGG
CCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAA
TCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTG
TCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGA
GAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATG
ATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCT
ACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACA
GTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGAC
CTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAAT
GCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCT
GGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCA
TCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGC
CAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCAC
TACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGAC
GCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACG
TTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGT
AGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACG
GAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCG
TTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAG
GACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAG
AATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGT
CTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGT
CGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACAC
CCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAA
TCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGA
GAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGG
ATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCA
GCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAAT
GGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACG
TGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCC
ACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCG
TGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTACA
AGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTG
GATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCC
CGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGT
GCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCT
ACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCC
ATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATT
CTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGC
GATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTAC
CATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGG
CCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATC
ATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAG
CTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAG
TCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTG
TCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGT
TAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGATG
GGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGC
ACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGT
AGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTC
AAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTT
CTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAA
TTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCAT
CTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAA
GGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTC
TTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAG
GACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGG
GGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACA
CTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTA
ACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCC
ATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTA
CACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATT
CAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAA
ACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGA
AGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATG
GGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGG
TACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGA
CATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGA
CTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGCTT
GTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAG
TTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGT
ACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGT
CTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAA
CAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACA
CGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGAT
GTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTT
CTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCA
CTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTT
AGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAA
GCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATG
TCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTG
GAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGA
ATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTT
CACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGC
GCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTA
TCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGT
ACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGG
TCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCA
ACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGC
AGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCT
GTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGT
TCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATG
TCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGA
TTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCAC
AGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTG
ACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTAC
GTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTC
GCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGG
ATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCC
GCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTG
GGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGT
CCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGA
CAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTC
CACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGG
CCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACA
CGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGG
ATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGAC
CGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACG
AGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTT
TCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTG
ATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTG
ACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGT
CTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCC
TCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATC
AAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGC
CATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTT
AAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCT
ACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATC
CGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTA
CAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGC
AATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTT
AGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTT
TACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATC
GGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAA
GAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTG
CGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCG
GTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAG
AAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCA
GCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGC
AGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGA
GACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCA
CTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCT
GACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGA
GTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCA
TCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTT
CAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCT
GGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACT
TCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACA
ACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCT
TCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACA
AAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGG
GTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGA
ATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAA
TAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGC
TACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACC
CCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCT
TCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGT
TACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGA
GGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCG
TTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAA
CTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCC
TGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATC
AGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCC
CATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGG
CAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAG
TTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTC
AAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTT
CATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACC
TGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTA
AGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCT
CCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAA
AGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCAT
GATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCT
CTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAA
CAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGT
CCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTAC
ACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCA
GGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATT
CCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTT
GGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCA
GTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTG
AGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGA
CAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAG
GACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCC
TGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGA
TGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCG
ATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGA
AATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGG
TCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGC
AGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAA
GATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGC
ATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGT
TAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTG
ATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGAC
GCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCG
AGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCA
CCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGA
TGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCAT
TCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTG
GACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCA
CGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACG
GCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGA
ACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGG
ACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTG
TGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCA
AATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGT
GTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCG
AAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTA
AGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTC
AAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCC
TGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGC
AAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAA
GCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTG
TTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGG
TGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGT
TTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTG
ACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTC
CATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTG
GGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAG
GCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACC
AGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGT
CTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGC
ATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTT
CGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCAT
TTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCG
AGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACA
GTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCA
CGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGT
ACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGC
ACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCC
AACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGG
GTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAG
GGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGA
CACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGG
TGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAG
GCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAA
TGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAG
GAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACA
ACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAA
CATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCA
CTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATT
CGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTC
TTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCA
CATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCC
AGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGA
CAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATA
TCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTG
GGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAG
CATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAG
AAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAG
TCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATG
GGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTG
GCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGT
GGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCA
TGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGT
TTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGC
ATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAA
TTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGT
GGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCC
GGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGA
TGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACA
ACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTT
GACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGA
TACAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTAT
TTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTC
GACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCC
TGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTG
AAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTA
ACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCA
CGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATG
GACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACA
ACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCAT
AAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAG
AGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCG
CTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGC
CCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGC
CTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAA
TATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGA
CGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTG
GAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCA
TTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGAC
TGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATG
GTTTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATT
GACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACT
TCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATC
ATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACA
GTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACT
GCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCAC
AGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCT
CCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCA
GCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATC
CTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGG
ATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCT
GATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAA
CCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTG
AGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGG
ACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCG
CCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGC
CAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACA
ATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTT
ATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGAC
GTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCAC
AAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAA
AGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATA
TGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTAC
ACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCC
GAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTC
ATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGA
CTTGATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTG
CGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGC
ATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTAT
CTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAAC
TGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGT
GCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGAC
CGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTC
TTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGG
CACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCT
GGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATG
TAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCT
GGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCA
GTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAG
TTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCA
TTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGA
CTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACG
GCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAAT
GTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGG
CAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGA
ACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAG
GTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAA
CCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCT
CTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAAT
GTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAG
CGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCA
GCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCT
ATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGG
GACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAA
ACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTG
GTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTT
CGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACG
TCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGG
ATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTA
CACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCT
CCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGT
CTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACC
CAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACT
ATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCA
TGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCT
AGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATG
GAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTAC
AAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACT
CCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGT
CTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGG
GAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGG
GACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGA
CTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACC
ATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTT
CATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGG
ATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTG
CCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGAC
ATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATA
TCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGA
CATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAA
AGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAA
GCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAG
CTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATC
ACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACG
TATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTG
TCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATC
CTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCC
AGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTA
GTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGA
CGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCG
AGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTA
AAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGT
ATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTA
TAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATC
CACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGG
AGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCA
TCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGT
CTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTT
CTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCG
CTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATG
GTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTA
TGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTT
CTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTAT
GATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAA
GACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACA
TCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTC
CTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCT
GCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATG
CTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGAC
ACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCT
CCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCC
ATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCG
CCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAAC
GGCATTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACG
TGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCA
GATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGG
AATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGA
CACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGAT
TATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCC
TACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCA
CACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGG
GCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTC
ACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATA
ATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGC
AATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTC
TGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACA
ACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTG
TCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGT
GCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGG
CTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCC
GCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTC
CTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAA
CACAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAA
GTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAA
CGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAG
TCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGA
AAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAG
AATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCG
TTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTAC
GTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGG
GGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCA
AAGACTTGATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAA
ACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAG
CGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATT
CTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCAC
CAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGT
CCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTG
TGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTC
GTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTC
ATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGT
GCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACA
GATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGA
TTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTT
TGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCC
CCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTT
CTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGC
TGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAA
GACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAG
CAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCA
CAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTA
CAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAG
CAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACG
CGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCG
TCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGA
CAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGA
ACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTC
GCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTG
GGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTG
TTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGA
TCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAG
TGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATAT
CTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGAC
AACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAG
CAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTG
ATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGT
CTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGT
GGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCC
CACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACA
CACTATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTT
GTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATA
CCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCC
TATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAG
CTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGT
CACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGG
GAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGA
CTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCA
TTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTG
GAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGG
AACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTG
ACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGA
GAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGA
TGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCAC
TGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATA
GATATCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCC
CCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCA
GCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGT
AGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACAT
TGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTACACAT
CATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAG
TACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAG
TGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTA
TATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCA
CTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAACGAC
ACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTA
GTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGG
ATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGT
TGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACC
ATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGA
GGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCAT
TATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCA
AAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTG
ACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGG
AGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACG
TGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGG
TCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGC
TATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTT
ACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCC
ATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGT
GTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTG
ACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACA
GACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGA
TGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCA
ATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGT
AATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGA
CGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGG
ATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGT
TTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAAC
ATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAG
AAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACACCAAGATC
TACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAG
TTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACACAGA
CTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATC
AGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCAT
AGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACC
TCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGAC
GTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAA
CAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACG
GCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATA
GATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAA
CGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGC
ATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCA
GACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGC
TTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCA
CAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAAT
GAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGC
ATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCC
ACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACA
CCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGAT
AGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAG
AGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGG
AAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGT
AGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGG
ACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTA
CCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTT
TTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTG
ACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAG
GTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTGACTACACCAC
TCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCG
ACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGAC
GATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAAC
GCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCA
ACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGAC
GGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGG
AGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTG
CTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATG
TGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCC
TACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCAC
TAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCC
GGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGAC
ACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAG
ATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAA
GCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGT
TGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACG
GGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACA
ACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTT
CGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGA
TCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAG
AACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGC
GTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCG
TGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGA
ATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGT
GTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACA
TGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGC
TCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCA
AGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTC
GCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTC
ATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAG
TGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAA
TCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATC
AGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAG
TGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACA
ACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACG
AGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGA
GACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGC
AGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAG
TATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAG
TCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACG
CCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGT
GCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTC
AGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGA
TAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATC
ACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGAC
CGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACT
TCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCC
TTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAA
TGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACG
GAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGG
GCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCC
GATAGATATCGACAGCAATGATGAGGAACGCCATGAACACACGGTCAGCG
TTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGC
TTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATGACTG
CAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACAGGGC
ACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGACTAC
ACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGG
ACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGACTACG
GTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTC
GCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAGATCT
GGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAACAGAA
CGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCA
TGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGT
TTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGA
TCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAACATCT
CACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCTCTCC
AGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAACAGTG
CCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGCAACA
GTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGG
CGTGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTTGATA
TTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCC
GACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGT
TGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGA
ATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCAC
ACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCAC
CGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTT
TTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTACCAG
TCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATCCTCA
CACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTGTGCC
GAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTCAGCA
TCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTACAGC
GTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGA
TGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGAC
ATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTT
TGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGG
GAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCATCTG
GCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACACCAA
GATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAA
AAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGACTACA
CAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGT
CATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTG
GCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCGTCAT
AACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACATTCAG
TGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCT
GTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCATGGTG
GACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACCACGT
CATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAACAACG
TCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGAT
GTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGA
AGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGAC
CAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTT
GCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGT
CAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTG
TTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAG
GCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAACTGTG
TACACCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAAATACGC
TGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGTATCT
GAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAA
GTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGA
GTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTG
GAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCA
TCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAATATG
TGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTTTTCT
TCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCTCAAT
AAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTGACTACA
CCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGAC
ACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAA
TGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCAACAA
CAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATATCAC
TGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTC
AGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTCATGG
ACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTCCATC
TCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTA
CATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGG
CGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCG
GCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAA
TGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATCGACA
CGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTA
GAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGG
AGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACACTGGA
CCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGAT
CACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTAC
TACAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCACAACC
CCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCT
GGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATGATTC
AAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGA
GCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATC
CTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGA
AGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTGTCTT
CAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGTTGAC
TACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTT
CCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACCCTAA
CCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGA
CTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGCCTCC
AGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGACTTCC
AAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGC
GGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTC
AATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGG
TGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATGCCAC
AACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCATAGT
GACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCT
CAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGACATG
CTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAGCTTA
CCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTACAGTC
TGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCAGCCA
GACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGA
GAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTG
TGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAACGTA
GTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGA
GATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGG
AGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAAGCAC
CACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAAACGT
AGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACAGAGG
CCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTTTAAG
GACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGATACGA
ATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCATGGG
CTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGAACACACGGTC
AGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTGTCCG
TGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATCAATG
ACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGCTACA
GGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACGCGGA
CTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTGCGAC
ATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAGTGAC
TACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCACATCC
CCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTCGAAG
ATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGCGAAC
AGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAGTCTC
TGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCGGGAA
AAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTCCTCG
GAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACGGAAC
ATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGCACCT
CTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACATCAAC
AGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACTATGC
AACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTCTCAA
ATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGACAACGCGGTT
GATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTAGCTG
GTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTACTGGG
CAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACCCGCA
GAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGGAAGG
CCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTTGTCA
GCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGAGGTT
GGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGGACTA
CCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCATGATC
CTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCCACTG
TGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACATGTC
AGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACGGTTA
CAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGGAGTT
CTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAGCCGC
TGACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCCAGTT
GGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTGGCGT
GCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAACTTCA
TCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCAGACA
CCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTGGGCA
GAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAGTGAC
TACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGATTCAC
AGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCCCGAC
TCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAATCTCG
TCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTACACAT
TCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGTGGTC
GCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGATCAT
GGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACGGACC
ACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCAAAAC
AACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCTTCAC
CGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACCAACT
TTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCCCAGC
GGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGATTCC
TGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATCGTTG
CCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTTTTCC
CTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAAGATG
CCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGACCAAC
TGTGTACACCAACACAATCCTGTAACGACATAACTGGAGGAAATCCAAAT
ACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCTCGGT
ATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTGGCTG
CCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATACGAG
TGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTGATCT
TTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGTGTCA
TCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGCAGAA
TATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAGTCTT
TTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCACAGCT
CAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACATTGAC
TACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGTTCTA
TGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTAGAAT
CGAATGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAGCGCA
ACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAAGATA
TCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACAGCCT
CGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGTCGTC
ATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCTCGTC
CATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTTCACC
ACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTCGGTA
TTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGCTTGA
CGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCTGTCG
ACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGACCATC
GACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGAACAT
TGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTGGAGT
CGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATCACAC
TGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTGCGGG
AGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAGCAGC
TTACTACAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCTCCAC
AACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATACAAGC
TCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGACATG
ATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCACAGCA
ACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGAGGGG
AATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAGGCCC
AGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGGCCTG
TCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCATCGT
TGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTGCAGG
CTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTTGACC
CTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACTCAGC
TGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAAACGC
CTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGTCGAC
TTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATCCGGA
AAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGTTCGT
CTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTCGAAG
TCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGAGATG
CCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTCACCA
TAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCTGACT
CGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAACGGA
CATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATAGCAG
CTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTGGTAC
AGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATCTTCA
GCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTCCAAA
TGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAGCCCG
TCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACACGAA
CGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTTGTGT
ACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACAGTGG
GTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTACTAA
GCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTATGAAA
ACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGTGACA
GAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACGCTTT
TAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGTCGAT
ACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATTGCCA
TGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGAACACAC
GGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTGGTTG
TCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGACATC
AATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTGACGC
TACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGACGACG
CGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAGTCTG
CGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCATCAG
TGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGTTCAC
ATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAACGTC
GAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCCACGC
GAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCGGCAG
TCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAGTCCG
GGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCATCGTC
CTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAACACG
GAACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCATCGGC
ACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGAACAT
CAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACATACT
ATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGCTGTC
TCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGACAACGC
GGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGTGTTA
GCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTTCTAC
TGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTACAACC
CGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTGCTGG
AAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGGCCTT
GTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCACCTGA
GGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGACCTGG
ACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATTCCAT
GATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAACATGCCC
ACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCAGACA
TGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGTGACG
GTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTGATGG
AGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGATGGAG
CCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCGAGCC
AGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACGAGTG
GCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCACAAC
TTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCCCGCA
GACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGTTGTG
GGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCAACAG
TGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGCTGAT
TCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTGACCC
CGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAAGAAT
CTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAGCTAC
ACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGACAGT
GGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGCCAGA
TCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGGAACG
GACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGTGGCA
AAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTGGGCT
TCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGGAACC
AACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTGCCCC
CAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCGGAGA
TTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAAGATC
GTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAGCTTT
TTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATGAGAA
GATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCAGGAC
CAACTGTGTACACCAACACAATCCTGTAACGACATAACTGGAGGAAATCC
AAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATCTCCT
CGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTTCCTG
GCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGAGATA
CGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTGTTTG
ATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTACGGT
GTCATCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTGGAGC
AGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTACGCAG
TCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGTTCAC
AGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAGACAT
TGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGTGTGT
TCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGGGCTA
GAATCGAATGACGATTCTATCTCACCGTACACGGACAATAAGGTCAGCAG
CGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGAATAA
GATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAGTACA
GCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAGGTGT
CGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTGTCCT
CGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTTTCTT
CACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGTGCTC
GGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACTCAGC
TTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTACGCT
GTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAGTGAC
CATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGACAGA
ACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACGCGTG
GAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGTCATC
ACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCGTCTG
CGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTCACAG
CAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTATCACTCCT
CCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTGATAC
AAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGGTCGA
CATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCTTCAC
AGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGAACGA
GGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCATGGAG
GCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCCATGG
CCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGTCCCA
TCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCAACTG
CAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTGACTT
GACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTCAACT
CAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGACAAA
ACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGGATGT
CGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCAGATC
CGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCCCGGT
TCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTGCTTC
GAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACCGTGA
GATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGGCGTC
ACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTGTGCT
GACTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCACAAA
CGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGGCATA
GCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAACTTG
GTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTTGATC
TTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAATGTC
CAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATAGTAG
CCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGATGACA
CGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGACCTT
GTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGCAACA
GTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGATCCTA
CTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGATGTAT
GAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCAATGT
GACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGGGACG
CTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGATTGGT
CGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGCTATT
GCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCATGAAC
ACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAAGCTG
GTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAACTGA
CATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTCATTG
ACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCGAGAC
GACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGCCGAG
TCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACAGGCA
TCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCCGTGT
TCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACGTCAA
CGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGTATCC
ACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCTACCG
GCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGCCAAG
TCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAGTCAT
CGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGAAGAA
CACGGAACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTGCCAT
CGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTGGGGA
ACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGTTACA
TACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCGTTGC
TGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGAACGACA
ACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCATCAGT
GTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCTCGTT
CTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGTTTAC
AACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCCTTTG
CTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAGCTGG
CCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCCCCAC
CTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAACGAC
CTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAGGATT
CCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGAACAT
GCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAAATCA
GACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACTACGT
GACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCTTCTG
ATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCGCGAT
GGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCTACTGCG
AGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCACTACG
AGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCCTTCA
CAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCATGCC
CGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCAGGGT
TGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGCACCA
ACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGAAGGC
TGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTTGCTG
ACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCATCAA
GAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACCAGAG
CTACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCGGTGA
CAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATCAAGC
CAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAGTAGG
AACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATGACGT
GGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATGGCTG
GGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCGTGGG
AACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAGGTTG
CCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATACCGCG
GAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACATCAA
GATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCACGAAG
CTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCTGATG
AGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCACCTCA
GGACCAACTGTGTACACCAACACAATCCTGTAACGACATAACTGGAGGAA
ATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGACATC
TCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGGACTT
CCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTTACGA
GATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGGTGTG
TTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCAACTA
CGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACACATTGCGTG
GAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAACGTAC
GCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTAATGT
TCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACCGTAG
ACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGATGGT
GTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTATTGG
GCTAGAATCGAATGACGATTCTATCTCACCGTACACGGACAATAAGGTCA
GCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGAGGGA
ATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGTACAG
TACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACGGCAG
GTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAATGTG
TCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGTCGTT
TCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCAGAGT
GCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAGGACT
CAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAGTGTA
CGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGACGGAG
TGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGTCGGA
CAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAATACG
CGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTCGCGT
CATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAACGCG
TCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCCTCTC
ACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTATCAC
TCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGTCCTG
ATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGACCTGG
TCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATCTTCT
TCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGGAAGA
ACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACGTCAT
GGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATCATCC
ATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGAGAGT
CCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAACCCA
ACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAACAGTG
ACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGCGGTC
AACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGGTGGA
CAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGACAAGG
ATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGCTTCA
GATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGGAGCC
CGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGGAGTG
CTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGTCACC
GTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCGACGG
CGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTAAGTG
TGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCAGTCA
CAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGACAGG
CATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAACTCAA
CTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGGCCTT
GATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCAACAA
TGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATCAATA
GTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGAGGAT
GACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAACAGA
CCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGACGTGC
AACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGTGGAT
CCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCGGGAT
GTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAATGTCA
ATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAGCTGG
GACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAGCGAT
TGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAACTGC
TATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACGCCAT
GAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCCCAAA
GCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTTGAAA
CTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGCTGTC
ATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGACCCG
AGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTGTGGC
CGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTCTACA
GGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCATATCC
GTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAGTACG
TCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACATCTGT
ATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGGAGCT
ACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACGCCGC
CAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTACCAG
TCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACCTAGA
AGAACACGGAACATCTCACCATGTATCCGGCATCAGGACATACCTGTGTG
CCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGAGGTG
GGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTGGAGT
TACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCGTCCG
TTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAAGAAC
GACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATTCCAT
CAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTTACCT
CGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGTGCGT
TTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATCCTCC
TTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAATGGAG
CTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGACGTCC
CCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTCCAAA
CGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGGGGAG
GATTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAATCGGA
ACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGATCAA
ATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACGTACT
ACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGCTTCT
TCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTGTGCG
CGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATATCTAC
TGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTCTCAC
TACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTATCTCC
TTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACACCCA
TGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAAAGCA
GGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAACCGC
ACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCATTGA
AGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGAACTT
GCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCACTCA
TCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAATGACC
AGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTACTCG
GTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTACATC
AAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTCGCAG
TAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATGGATG
ACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAGCATG
GCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTTTTCG
TGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGTAGAG
GTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTCATAC
CGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTCTACA
TCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTCCCAC
GAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTATCCCT
GATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGCGCAC
CTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGACATAACTGGA
GGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGACGGA
CATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCTGGGG
ACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTCAGTT
ACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCAGCGG
TGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGTGCCA
ACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACACATTG
CGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAACAAC
GTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCTCCTA
ATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGCCACC
GTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCTGGGA
TGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTTGCTA
TTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGGACAATAAG
GTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGAATGA
GGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTGCTGT
ACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCCAACG
GCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACACAAA
TGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCGGAGT
CGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGCAGCA
GAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTGCAAG
GACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCGAAAG
TGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTCTGAC
GGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGGAGGT
CGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGCCCAA
TACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTCTTTC
GCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTCTAAA
CGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGTTCCC
TCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCACATTA
TCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAGAAGT
CCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGCCGAC
CTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTACGATC
TTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGCCGGG
AAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGCAACG
TCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCAGATC
ATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACATGGA
GAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGAGGAA
CCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAATCAAC
AGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCGTGGC
GGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCCATGG
TGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAGTGAC
AAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGGATGC
TTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGCATGG
AGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCCCAGG
AGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCTACGT
CACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCGTCCG
ACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACAGCTA
AGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACCACCA
GTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGACACGA
CAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGATAAC
TCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATATTGGG
CCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCCATCA
ACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGATCATC
AATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTTGGGA
GGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCAGCAA
CAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAATGAC
GTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGACCGGT
GGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCAGTCG
GGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCTGAAT
GTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGTTTAG
CTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGCCGAG
CGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAAAGAA
CTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGGAACG
CCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGCTGCC
CAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTCAGTT
GAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAACATGC
TGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTATGGA
CCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGCCGTG
TGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGGAGTC
TACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTCCCAT
ATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGGCGAG
TACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATCACAT
CTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGCCAGG
AGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCACACG
CCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGACTTA
CCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTGGACC
TAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGACATACCTG
TGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCACAGA
GGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAACAGTG
GAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACTGTCG
TCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTGACAA
GAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTGGATT
CCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGGGGTT
ACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACGTGGT
GCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATAGATC
CTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGAGAAT
GGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTGAGAC
GTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGACCCTC
CAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACATTGG
GGAGGATTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGAGAAT
CGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTTGGGA
TCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTTTACG
TACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTACCGC
TTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGGACTG
TGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGCATAT
CTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGCTCTC
TCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATCTTAT
CTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGACAACA
CCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACAACAA
AGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGATGCAA
CCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGGCTCA
TTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCTGGGA
ACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTATCCA
CTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGGAAAT
GACCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAACAGCTA
CTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAATCTA
CATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCACGTTC
GCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCGGATG
GATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGCTTAG
CATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCGAGTT
TTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGACCTGT
AGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTGGTTC
ATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAACAGTC
TACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTGCTTC
CCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTTCTAT
CCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCACATGC
GCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGACATAAC
TGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGACCTGA
CGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCCTGCT
GGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCCTTTC
AGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTGGGCA
GCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAACGGT
GCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTCACAC
ATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCACAAA
CAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTACACCT
CCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACATCTGC
CACCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGCGGCT
GGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGAAGTT
GCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGGACAA
TAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCTCTGA
ATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGTACTG
CTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAGCGCC
AACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAGTACA
CAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGACTCG
GAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGGCTGC
AGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACCGCTG
CAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTTCTCG
AAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAAGGTC
TGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACGTTGG
AGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCCAAGC
CCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTACCTTC
TTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCGGTTC
TAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGCAGGT
TCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGACTCAC
ATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGATGAAG
AAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTACCGC
CGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAGTTAC
GATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCGACGC
CGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCTGTGC
AACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAACTTCA
GATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTGGACA
TGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACAAGGA
GGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAGCAAT
CAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACTGTCG
TGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACCAGCC
ATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGATCCAG
TGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAACTGGG
ATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAATAGGC
ATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAGACCC
CAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACAGTCT
ACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCATGTCG
TCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAGCACA
GCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGCAACC
ACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCACTGAC
ACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTTCAGA
TAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACTATAT
TGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCGCGCC
ATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCCAGAT
CATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCACAGTT
GGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGAGGCA
GCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCGGAAA
TGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTAGGAC
CGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAACCCA
GTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCCGCCT
GAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATCGCGT
TTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTCGAGC
CGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGAGAAA
AGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGATGAGG
AACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTACCGGC
TGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGTCTTC
AGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCTCAAC
ATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGCCGTA
TGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGGCGGC
CGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATCGAGG
AGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCAGTTC
CCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTACTGG
CGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGCTATC
ACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTTTAGC
CAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAGACCA
CACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGAAAGA
CTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTTTGTG
GACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGACATA
CCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAATTCA
CAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCTTAAC
AGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCGGACT
GTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCCCCTG
ACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATCACTG
GATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGAGCGG
GGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGATGACG
TGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGCGATA
GATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGGCGGA
GAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTGGCTG
AGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCACGGAC
CCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTGCACA
TTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTACAAGTGGA
GAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGATCTT
GGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCGGTTT
TACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGCACTA
CCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTACAGGG
ACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCATCTGC
ATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCTCAGC
TCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGATATC
TTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCATGAC
AACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCCTACA
ACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCATTGAT
GCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCTGGGG
CTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTCGCCT
GGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTCTGTA
TCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTAGCGG
AAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGGAACA
GCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCACAGAA
TCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAGGCAC
GTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAAAGCG
GATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCTTCGC
TTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATTATCG
AGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCTGGAC
CTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGGAGTG
GTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTTCAAC
AGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGACCTG
CTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGGTTTT
CTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACTGCAC
ATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAACGACA
TAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCATCGAC
CTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACACTCC
TGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCAGGCC
TTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAACCGTG
GGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAGCAAA
CGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGGGCTC
ACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTACTCA
CAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACATTAC
ACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACTACAT
CTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGTTTGC
GGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTTTTGA
AGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTACACGG
ACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCTATCT
CTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACAAGGT
ACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACGATAG
CGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGTTGAG
TACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCTGGGA
CTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACTACGG
CTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAGAACC
GCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGCACTT
CTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTCGCAA
GGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGAAACG
TTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAATCGCC
AAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCACTAC
CTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGCTGCG
GTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATCTTGC
AGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTACAGAC
TCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTCAGAT
GAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAACTGTA
CCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAGAAAG
TTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGTAGCG
ACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTCGGCT
GTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTCGAAC
TTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATTTGTG
GACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAGTACA
AGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGACCAAG
CAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGTCACT
GTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGCAACC
AGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGATGGAT
CCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGCAAAC
TGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGGCAAT
AGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCCGAAG
ACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACAAACA
GTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCACCAT
GTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCCGCAG
CACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACGAGGC
AACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGATTCAC
TGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCGGGTT
CAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAGTACT
ATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTCTCCG
CGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGATGTCC
AGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGACCCAC
AGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCTTCGA
GGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTCGGCG
GAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAAAGTA
GGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCATCAA
CCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAAGGCC
GCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTACAATC
GCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCGTGTC
GAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACAGAGA
GAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAATGAT
GAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAGCTAC
CGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTACAGT
CTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGGACCT
CAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGAATGC
CGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCGCTGG
CGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGTCATC
GAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAAGCCA
GTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGCACTA
CTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAGACGC
TATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGACGTT
TAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACTGTAG
ACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGACGGA
AAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGTCGTT
TGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATCAGGA
CATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCAAGAA
TTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGGGTCT
TAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTCGTCG
GACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAACACCC
CCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTCAATC
ACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAAGAGA
GCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGTGGAT
GACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAATCAGC
GATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATAATGG
CGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTACGTG
GCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCCCCAC
GGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTCCGTG
CACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTACAAG
TGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGGTGGA
TCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTTCCCG
GTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACTGTGC
ACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTGCTAC
AGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAGCCAT
CTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCATTCT
CAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCAGCGA
TATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTTACCA
TGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAAGGCC
TACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCATCAT
TGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTGAGCT
GGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAGAGTC
GCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCCTGTC
TGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAGGTTA
GCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGATGGG
AACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCTGCAC
AGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACAGTAG
GCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCCTCAA
AGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACACTTCT
TCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGGAATT
ATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCCATCT
GGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGGAAGG
AGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGTTCTT
CAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAGAGGA
CCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACAGGGG
TTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGACACT
GCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTGTAAC
GACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATGCCAT
CGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGATTACA
CTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAATTCA
GGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTCAAAC
CGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAGGAAG
CAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGATGGG
GCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCATGGTA
CTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTAGACA
TTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGATGACT
ACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGCTTGT
TTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAGAGTT
TTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACCGTAC
ACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATGGTCT
ATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTCAACA
AGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGACACG
ATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACGATGT
TGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGCTTCT
GGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAACCACT
ACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGACTTAG
AACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTGAAGC
ACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAATGTC
GCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGTTGGA
AACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAAGAAT
CGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAGTTCA
CTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAAGCGC
TGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTGTATC
TTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAAGTAC
AGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGCGGTC
AGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTTCAAC
TGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTGGCAG
AAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTTCTGT
AGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGACGTTC
GGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCATGTC
GAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGGGATT
TGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGCACAG
TACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAGTGAC
CAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCTACGT
CACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCATTCGC
AACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCGGGAT
GGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTTCCGC
AAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAGTGGG
CAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGTGTCC
GAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACGGACA
AACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTACTCCA
CCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCACGGCC
GCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAACACG
AGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGTGGAT
TCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGGACCG
GGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACACGAG
TACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTGTTTC
TCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGCTGAT
GTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATGTGAC
CCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGAGTCT
TCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAACCCTC
GGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACATCAA
AGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACTGCCA
TCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCGTTAA
GGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTTCTAC
AATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACATCCG
TGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAGTACA
GAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACAGCAA
TGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATCTTAG
CTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGGTTTA
CAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCATCGG
ACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAAAAGA
ATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTCTGCG
CTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGGCGGT
CATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGCAGAA
GCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGGCAGC
ACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATGGCAG
ACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTTGAGA
CGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCATCACT
GTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATTCTGA
CGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGGGAGT
CGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGGCATC
AGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATGTTCA
AGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAACCTGG
GTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGACTTC
GTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATACAAC
ACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTTCTTC
AATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGACAAA
GAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTGGGGT
GGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAAGAAT
CAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAACAATA
ATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACGGCTA
CGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGACCCC
CCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAACCTTC
CGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAAGTTA
CAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAGGAGG
TGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCTCGTT
CCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCCAACT
GTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCTCCTG
CTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATATCAG
CCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACGCCCA
TTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGAGGCA
GCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATTAGTT
ACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTGTCAA
GGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGTTTCA
TCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGACCTG
AGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTCTAAG
AGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCATCTCC
TGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGTAAAG
GTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGCATGA
TGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAGCTCT
GCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCCAACA
GTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGCGTCC
TCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCTACAC
TTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGATCAGG
AATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGATTCC
ATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACCTTGG
AAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAGCAGT
TCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGACTGAG
AGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCCGACA
GGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCAAGGA
CACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAATCCTG
TAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTATGATG
CCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGTCGAT
TACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAAGAAA
TTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAGGGTC
AAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATGGCAG
GAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACACAAGA
TGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGAGCAT
GGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCATGTTA
GACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACTTGAT
GACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCGACGC
TTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCATCGAG
AGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCTCACC
GTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTGGATG
GTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGCATTC
AACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCGTGGA
CACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTTCACG
ATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCACGGC
TTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGGGAAC
CACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTAGGAC
TTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGGTGTG
AAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGTCAAA
TGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTTGTGT
TGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATTCGAA
GAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACTTAAG
TTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGCTCAA
GCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGTCCTG
TATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCAGCAA
GTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAACAAGC
GGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGTTGTT
CAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACCGGTG
GCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCTGTTT
CTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGTTGAC
GTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCGTCCA
TGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGCTGGG
GATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTATAGGC
ACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGACCAG
TGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAACGTCT
ACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGTGCAT
TCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCGTTCG
GGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTCATTT
CCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGATCGAG
TGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACACAGT
GTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCCCACG
GACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCTGTAC
TCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCAGCAC
GGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTATCCAA
CACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATGGGGT
GGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAGAGGG
ACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGAGACA
CGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAAGGTG
TTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCCAGGC
TGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCTAATG
TGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGAAGGA
GTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGACAAC
CCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACTAACA
TCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCATCACT
GCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCATTCG
TTAAGGCCGCCTGAATGTCAATGTGACAGAGGCCAATGGAGAGGATTCTT
CTACAATCGCGTTTAGCTGGGACGCTTTTAAGGACGGAGATGTGCCCACA
TCCGTGTCGAGCCGAGCGATTGGTCGATACGAATGGGCACTGACATCCAG
TACAGAGAGAAAAGAACTGCTATTGCCATGGGCTCCGATAGATATCGACA
GCAATGATGAGGAACGCCATGAACACACGGTCAGCGTTCCCCGACATATC
TTAGCTACCGGCTGCCCAAAGCTGGTTGTCCGTGGCTTCAGCAAAGTGGG
TTTACAGTCTTCAGTTGAAACTGACATCAATGACTGCAGTAGAAGCAGCA
TCGGACCTCAACATGCTGTCATTGACGCTACAGGGCACATTGAGCTAGAA
AAGAATGCCGTATGGACCCGAGACGACGCGGACTACACATCATCACAGTC
TGCGCTGGCGGCCGTGTGGCCGAGTCTGCGACATGGACAGTACGTATGGG
CGGTCATCGAGGAGTCTACAGGCATCAGTGACTACGGTAGTGTGTCTGGC
AGAAGCCAGTTCCCATATCCGTGTTCACATCCCCTCGCTATATCCTGTGG
CAGCACTACTGGCGAGTACGTCAACGTCGAAGATCTGGCACTCCAGCATG
GCAGACGCTATCACATCTGTATCCACGCGAACAGAACGACACTAGTGTTT
GAGACGTTTAGCCAGGAGCTACCGGCAGTCTCTGCATGTAGTGACGGCAT
CACTGTAGACCACACGCCGCCAAGTCCGGGAAAAGTTTGGATCGAGAATT
CTGACGGAAAGACTTACCAGTCATCGTCCTCGGAGATCGTTGTAAAGTGG
GAGTCGTTTGTGGACCTAGAAGAACACGGAACATCTCACCATGTATCCGG
CATCAGGACATACCTGTGTGCCATCGGCACCTCTCCAGGAGGTATAGATG
TTCAAGAATTCACAGAGGTGGGGAACATCAACAGTGCCATTATCCACAAC
CTGGGTCTTAACAGTGGAGTTACATACTATGCAACAGTCAAAGGAGTTGA
CTTCGTCGGACTGTCGTCCGTTGCTGTCTCAAATGGCGTGACCATCGATA
CAACACCCCCTGACAAGAACGACAACGCGGTTGATATTGGAGGTCTATTT
CTTCAATCACTGGATTCCATCAGTGTTAGCTGGTCCGACGTGTTCTTCGA
CAAAGAGAGCGGGGTTACCTCGTTCTACTGGGCAGTTGGGTCCGCTCCTG
GGGTGGATGACGTGGTGCGTTTACAACCCGCAGAGAATGCTATGGTTGAA
GAATCAGCGATAGATCCTCCTTTGCTGGAAGGCCACACTTACTATGTAAC
AATAATGGCGGAGAATGGAGCTGGCCTTGTCAGCACCGCCATTTCTCACG
GCTACGTGGCTGAGACGTCCCCACCTGAGGTTGGTTTTGTGTATGATGGA
CCCCCCACGGACCCTCCAAACGACCTGGACTACCAGTCTGACAAGACAAC
CTTCCGTGCACATTGGGGAGGATTCCATGATCCTCACACAGACATCATAA
GTTACAAGTGGAGAATCGGAACATGCCCACTGTGCCGAGATGTCCTAGAG
GAGGTGGATCTTGGGATCAAATCAGACATGTCAGCATCCAATCTGCCGCT
CGTTCCCGGTTTTACGTACTACGTGACGGTTACAGCGTGTAATGCTGCCC
AACTGTGCACTACCGCTTCTTCTGATGGAGTTCTGATGGACGACACGCCT
CCTGCTACAGGGACTGTGCGCGATGGAGCCGCTGACATGGATCTCCAATA
TCAGCCATCTGCATATCTACTGCGAGCCAGTTGGTTTGGTTTCCATGACG
CCCATTCTCAGCTCTCTCACTACGAGTGGCGTGCGGGAACATCGCCTGGA
GGCAGCGATATCTTATCTCCTTCACAACTTCATCTGGCAGAAACGGCATT
AGTTACCATGACAACACCCATGCCCGCAGACACCAAGATCTACGTGACTG
TCAAGGCCTACAACAAAGCAGGGTTGTGGGCAGAAAAAAGTTCAGATGGT
TTCATCATTGATGCAACCGCACCAACAGTGACTACACAGACTGGAATTGA
CCTGAGCTGGGGCTCATTGAAGGCTGATTCACAGGTCATCAGGACACTTC
TAAGAGTCGCCTGGGAACTTGCTGACCCCGACTCTGGCATAGATTATCAT
CTCCTGTCTGTATCCACTCATCAAGAATCTCGTCATAACCTCCCTACAGT
AAAGGTTAGCGGAAATGACCAGAGCTACACATTCAGTGACGTCACACTGC
ATGATGGGAACAGCTACTCGGTGACAGTGGTCGCCTGTAACAGGGCACAG
CTCTGCACAGAATCTACATCAAGCCAGATCATGGTGGACGGCTCACCTCC
AACAGTAGGCACGTTCGCAGTAGGAACGGACCACGTCATAGATAATCAGC
GTCCTCAAAGCGGATGGATGACGTGGCAAAACAACGTCAACGGCAATCCT
ACACTTCTTCGCTTAGCATGGCTGGGCTTCACCGATGTGCATTCTGGGAT
CAGGAATTATCGAGTTTTCGTGGGAACCAACTTTGAAGCAGACAACCTGA
TTCCATCTGGACCTGTAGAGGTTGCCCCCAGCGGACCAGCTTTGTCAACC
TTGGAAGGAGTGGTTCATACCGCGGAGATTCCTGTTGCCACAGTGCTGAG
CAGTTCTTCAACAGTCTACATCAAGATCGTTGCCGTCAATGAGGCTGGAC
TGAGAGGACCTGCTTCCCACGAAGCTTTTTCCCTTGTTGCATCCGCCGCC
GACAGGGGTTTTCTATCCCTGATGAGAAGATGCCAGGCCCACTCCTGCCA
AGGACACTGCACATGCGCACCTCAGGACCAACTGTGTACACCAACACAAT
CCTGTAACGACATAACTGGAGGAAATCCAAATACGCTGATAGAAGTTTAT
GATGCCATCGACCTGACGGACATCTCCTCGGTATCTGAAGAGAACGACGT
CGATTACACTCCTGCTGGGGACTTCCTGGCTGCCAAGTGGAAAGTCACAA
GAAATTCAGGCCTTTCAGTTACGAGATACGAGTGGAGTGTAGGAAAAAAG
GGTCAAACCGTGGGCAGCGGTGTGTTTGATCTTTTGGAGGACAGAATATG
GCAGGAAGCAAACGGTGCCAACTACGGTGTCATCCATCTACCCGTTACAC
AAGATGGGGCTCACACATTGCGTGGAGCAGAATATGTGTTTTACGTCCGA
GCATGGTACTCACAAACAACGTACGCAGTCTTTTCTTCTGACGGGGTCAT
GTTAGACATTACACCTCCTAATGTTCACAGCTCAATAAAGGTCAAAGACT
TGATGACTACATCTGCCACCGTAGACATTGACTACACCACTCAAACTGCG
ACGCTTGTTTGCGGCTGGGATGGTGTGTTCTATGACACCGACAGCGGCAT
CGAGAGTTTTGAAGTTGCTATTGGGCTAGAATCGAATGACGATTCTATCT
CACCGTACACGGACAATAAGGTCAGCAGCGCAACAACAACGCACCAACTG
GATGGTCTATCTCTGAATGAGGGAATAAGATATCACTGCAACGTCCGTGC
ATTCAACAAGGTACTGCTGTACAGTACAGCCTCGTCAGACGGTGTGACCG
TGGACACGATAGCGCCAACGGCAGGTGTCGTCATGGACGGAGTCGTTCTT
CACGATGTTGAGTACACAAATGTGTCCTCGTCCATCTCTGCTTCATGGCA
CGGCTTCTGGGACTCGGAGTCGTTTCTTCACCACTACATGTGGTGCCTGG
GAACCACTACGGCTGCAGCAGAGTGCTCGGTATTGGCGCCTACAGATGTA
GGACTTAGAACCGCTGCAAGGACTCAGCTTGACGCGGCACTAGATTCTGG
TGTGAAGCACTTCTCGAAAGTGTACGCTGTCGACAATGCCGGTTTGCAGT
CAAATGTCGCAAGGTCTGACGGAGTGACCATCGACACGACACCCCCAGTT
GTGTTGGAAACGTTGGAGGTCGGACAGAACATTGTAGAAGATTTCTCATT
CGAAGAATCGCCAAGCCCAATACGCGTGGAGTCGGGAGAAGCGCTGGACT
TAAGTTCACTACCTTCTTTCGCGTCATCACACTGGACCGTTGAAGACGGC
TCAAGCGCTGCGGTTCTAAACGCGTCTGCGGGAGATCACGGGAGCAATGT
CCTGTATCTTGCAGGTTCCCTCTCACAGCAGCTTACTACAACCACAGGCA
GCAAGTACAGACTCACATTATCACTCCTCCACAACCCCTTCGTACAGAAC
AAGCGGTCAGATGAAGAAGTCCTGATACAAGCTCCTGGGATCAGCAAGGT
TGTTCAACTGTACCGCCGACCTGGTCGACATGATTCAAAGAACGCGAACC
GGTGGCAGAAAGTTACGATCTTCTTCACAGCAACGAGCGCGTCGTCCTCT
GTTTCTGTAGCGACGCCGGGAAGAACGAGGGGAATCCTCGTGGACAATGT
TGACGTTCGGCTGTGCAACGTCATGGAGGCCCAGGAAGGAATGAACAGCG
TCCATGTCGAACTTCAGATCATCCATGGCCTGTCTTCAGTGTTCGCCAGC
TGGGGATTTGTGGACATGGAGAGTCCCATCGTTGACTACATGTGGGCTAT
AGGCACAGTACAAGGAGGAACCCAACTGCAGGCTTTCCGCTCTGTTGGGA
CCAGTGACCAAGCAATCAACAGTGACTTGACCCTAACCCAAGGATCAAAC
GTCTACGTCACTGTCGTGGCGGTCAACTCAGCTGGACTTCGCAGTGTGGT
GCATTCGCAACCAGCCATGGTGGACAAAACGCCTCCAGTCATATCTTTCG
TTCGGGATGGATCCAGTGACAAGGATGTCGACTTCCAAAGTGACAACGTC
ATTTCCGCAAACTGGGATGCTTCAGATCCGGAAAGCGGAATCAGCAGGAT
CGAGTGGGCAATAGGCATGGAGCCCGGTTCGTCTTCAATCAGTGATTACA
CAGTGTCCGAAGACCCCAGGAGTGCTTCGAAGTCGGTGAGTGGTCTCTCC
CACGGACAAACAGTCTACGTCACCGTGAGATGCCACAACAACGTGGGTCT
GTACTCCACCATGTCGTCCGACGGCGTCACCATAGTGACGAGCCCACCCA
GCACGGCCGCAGCACAGCTAAGTGTGCTGACTCGCTCAGAGACACACTAT
CCAACACGAGGCAACCACCAGTCACAAACGGACATGCTGCAGTTGTCATG
GGGTGGATTCACTGACACGACAGGCATAGCAGCTTACCAGTATACCCTAG
AGGGACCGGGTTCAGATAACTCAACTTGGTACAGTCTGAGTCCCTATGGA
GACACGAGTACTATATTGGGCCTTGATCTTCAGCCAGACGCCAGCTACAA
GGTGTTTCTCCGCGCCATCAACAATGTCCAAATGGAGAGTGCGTCACTCC
AGGCTGATGTCCAGATCATCAATAGTAGCCCGTCTGTGTCAGGGGAGTCT
AATGTGACCCACAGTTGGGAGGATGACACGAACGTAGTGATAGACTGGGA
AGGAGTCTTCGAGGCAGCAACAGACCTTGTGTACGAGATCACCATTGGGA
CAACCCTCGGCGGAAATGACGTGCAACAGTGGGTGGAGACCGTGGAGACT
AACATCAAAGTAGGACCGGTGGATCCTACTAAGCACCACTTCGGAACCAT
CACTGCCATCAACCCAGTCGGGATGTATGAAAACGTAGCCTTTGACTTCA
TTCGTTAA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96929gene:BL96929Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96929_cuf0transcript:BL96929_cuf0-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96929_cuf0-E1BL96929_cuf0-E1-1564476830-120833Branchiostoma lanceolatumexon
BL96929_cuf0-E2BL96929_cuf0-E2-1564476830-120831Branchiostoma lanceolatumexon
BL96929_cuf0-E3BL96929_cuf0-E3-1564476830-120829Branchiostoma lanceolatumexon
BL96929_cuf0-E4BL96929_cuf0-E4-1564476830-120827Branchiostoma lanceolatumexon
BL96929_cuf0-E5BL96929_cuf0-E5-1564476830-120825Branchiostoma lanceolatumexon
BL96929_cuf0-E6BL96929_cuf0-E6-1564476830-120823Branchiostoma lanceolatumexon
BL96929_cuf0-E7BL96929_cuf0-E7-1564476830-120821Branchiostoma lanceolatumexon
BL96929_cuf0-E8BL96929_cuf0-E8-1564476830-120819Branchiostoma lanceolatumexon
BL96929_cuf0-E9BL96929_cuf0-E9-1564476830-120817Branchiostoma lanceolatumexon
BL96929_cuf0-E10BL96929_cuf0-E10-1564476830-120815Branchiostoma lanceolatumexon
BL96929_cuf0-E11BL96929_cuf0-E11-1564476830-120813Branchiostoma lanceolatumexon
BL96929_cuf0-E12BL96929_cuf0-E12-1564476830-120811Branchiostoma lanceolatumexon
BL96929_cuf0-E13BL96929_cuf0-E13-1564476830-120809Branchiostoma lanceolatumexon
BL96929_cuf0-E14BL96929_cuf0-E14-1564476830-120807Branchiostoma lanceolatumexon
BL96929_cuf0-E15BL96929_cuf0-E15-1564476830-120805Branchiostoma lanceolatumexon
BL96929_cuf0-E16BL96929_cuf0-E16-1564476830-120803Branchiostoma lanceolatumexon
BL96929_cuf0-E17BL96929_cuf0-E17-1564476830-120801Branchiostoma lanceolatumexon
BL96929_cuf0-E18BL96929_cuf0-E18-1564476830-120799Branchiostoma lanceolatumexon
BL96929_cuf0-E19BL96929_cuf0-E19-1564476830-120797Branchiostoma lanceolatumexon
BL96929_cuf0-E20BL96929_cuf0-E20-1564476830-120795Branchiostoma lanceolatumexon
BL96929_cuf0-E21BL96929_cuf0-E21-1564476830-120793Branchiostoma lanceolatumexon
BL96929_cuf0-E22BL96929_cuf0-E22-1564476830-120791Branchiostoma lanceolatumexon
BL96929_cuf0-E23BL96929_cuf0-E23-1564476830-120789Branchiostoma lanceolatumexon
BL96929_cuf0-E24BL96929_cuf0-E24-1564476830-120787Branchiostoma lanceolatumexon
BL96929_cuf0-E25BL96929_cuf0-E25-1564476830-120785Branchiostoma lanceolatumexon
BL96929_cuf0-E26BL96929_cuf0-E26-1564476830-120783Branchiostoma lanceolatumexon
BL96929_cuf0-E27BL96929_cuf0-E27-1564476830-120781Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000014genomeSc0000014:2282670..2294219 -
Properties
Property NameValue
Transcript idBL96929_cuf0
Biotypeprotein_coding