Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96926_cuf8 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96926_cuf8
Unique Nametranscript:BL96926_cuf8
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96926_cuf8

>transcript:BL96926_cuf8-protein ID=transcript:BL96926_cuf8-protein|Name=transcript:BL96926_cuf8|organism=Branchiostoma lanceolatum|type=polypeptide|length=608bp
MLSKHDVEEEYISGASLTFTPFIVDPQTTKNDSERSLNGRLRDFAESFFI
SLLHDKPLTGPLEITIPINPDLIPEGTLPVLLFWSTERQQWMDASLTCLN
SENNMGYDWEQNLLHVNVCSTHPTSKTLGDNVRRRRSSEEEFFTGSTQFA
EFSVDSDVINTPPVVTSPSAMWMYEDSGTLRAQLLAQDAEGDELIFSLDT
EEDVMGDVVLSPEGLLEYTPCLHCFGPVEISYVVQEKPTGQTAPLEVRVT
LTIDVRPQNDNPDLLLLRDGVNVVSDQGPNTYSPVDLPVKQGNEHSIVLW
LYDVDAADDLVFNVSQPQYGAVQIGPMCKKVTFLSTPCNMDNINDFHVIN
GNCTVCEPDNLNTTGSKEVDDLSWALTRLTYISRNESFFGKDSFAIHGID
GNGGTSKILRIDVFVLQKCRNNGTCIGPAEDPECNDLQLAFGFDGYVCDC
TEGFIGEFCQIEIVPCSPPTAPVNGAVSPEDSTSYQDVVEFWCDPGYELV
GDSAHMCHWDGSWNGTTPSCDPVPCPTLSAPANGALSPSGPHVYQDVVNF
TCSEGYVVAGVSTVTCQADGTWTGSVPTCKSEITFSVILYNSKLLNLNLT
MSFAYKYM
Run BLAST on NCBI

mRNA from alignment at Sc0000014:2373327..2386115+

Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96926_cuf8 ID=transcript:BL96926_cuf8|Name=transcript:BL96926_cuf8|organism=Branchiostoma lanceolatum|type=mRNA|length=12789bp|location=Sequence derived from alignment at Sc0000014:2373327..2386115+ (Branchiostoma lanceolatum)
GAGCTACATATTGATGGGCAGTACTTTACAACAATAACTGGGATCCCTCC GGTCAGCTTGTCAACGAAGTTAATTCTGGCTGTTAGAAGCAAGCAAGGAG CGGTTGCTGAATTCCATGATGTCTTCAACCCACCATCTGTGAGGGCCTTC TTCAAGAACCTAAGGTTAGTAAAAAATATTTGATTTGCAACTTGGTCACT GAAAAGCATCCTTTGAAACAATGGAAACTGATACTGTTATGTTCATGAAC AGTTACTATGTACTTAGTTGCAGATATTTGCCTCTGTCATTTTTCAAGGC TAGAATATTACAATTTTGATTATAATGTTTATAACAGTATCATTACTACA GCAGACTTTTGGTGGAATTTATGCAAAAATACAGCAATTATTCAAATCAC TTTACATTCCTTTTTATAGGACCCCACCATCAGCTGATATGTTATGCCGA TACGGTACTCCATTCCAAGATGGCAGCACCACCATTTTGAAGTTATATGC CGGTGTTGGTACGAGTAAGGGGGCAGATGATGTCAAGACATTCTTTGAGG TAAAGAATTAGAACAAACTTGGAAGGGTCATTCATTCAAACATTCACTCT GCTGTTAGATCTGTTCCATGAATATTCACCAAATGTATTTTTTATCAATA TGGGAAACATAAACTTAACATATTTTACATTGTGTGATACATGTATTAGA AAATGAAGTGAATATCGTCACACCATATATGTTAATGTCCACCTGCCAAT GTGGTGTTCCATAATGTTCTATATGACTAATTGTAGGCTGGTATGGAATT GTTCTGAATTATTGATTGATTGATTGATTGATTGATTGATCATTTGGATG ATTGATTGATTGATTGGTTTGACTGTTCAGGACACACAGTACAGCCAGGG CTGTCCAAATGGCCTGTGGCGATTACAAAGGGCTAGTCCTGCTGACAAAG ACAAAACATCACAATGGAATTAGACATGGACAGCATAACAATCTATTACA TCATATTCTAATGATTGTTTTCCCTCAGGTTGAAGACCTCTGCACACCCT GCATGGATGACTGCAGTACATACAGTTGTGACATGAACTGCACGGTTGAT GATACAACACTTCATCACGTGCTCATCACCAACCTCCACCTGTCAACTCA CATGATGATCACTCAAGATAACGCCACCATATCTGTTCCTGCTCTCTACT ATGTTACAATAAAGGCTGTCTCAGGTAGGGGAATCTTTTTTCTTTAAAAA CTATGCAATGCTTATGAATATTATTAGTACTTTGTGTTGTCATGTAGGGG GATCTTTTTCTTTAAAAATTATGCAATACACATTCATTGAGTATTAAGTA CTTTTTGTCATCATGTAGACTCAATATTGATGATATACAAATGTATGATA CATTCCATTTCCTTTGCAAGATGATGTCACTACTAACAATTGGGTGCACC ATACAATTATATTGCATAATACATGGACCTGGAAGTAATCTAATTAGTAC TAACTCCTCATCCTTGTATCTGACTACTAATGATTTGTTTTTACCTAAAT GTGTAAGACCAAATTTTTTGTTGACAGCTTTTTTCTCCTGTCATAGTGTT GACTGCTATTCACAATAACAATCTTTACGCACCACAATATTGCAACGTTG AATGTATTTTACTTGTTTATTTCAAACAAGGGTCTGGTCGCTTTGCGTTG TCCTCCTCGGATGGAGTGTACATTGATGCGACCCCGCCAGTATTTGAATC CTTGTACCATGTGGATCTTACCTGGTCTGAAGATGAACAGTCTGATTTCC AAGGGAGCAACAGCACCATCGCCGTTAGGTGGGAAGCGTATGACATAGAA AGTCAGGTACGTATTTTCCCAGAACCATTATGATAGTAGAATGGAACTCG TTGTCATCAAATGCTGTAGGACCATCCTCACTAGATAGCTTTAAAGAACG GTTGCAGTCAGATGTGCAAAGACTAGGTGTGACAAGTTGTTCAGTGTAAT ATAGCTAGCTACTGCCGTGCTGCGTTCCTGCAAAGCTGGTGTCTTATACG CCGAAGGGTGGTTATACTGGCTCTACAGATACAGATCTAGATACGTACAA AACACTACCATTTTGAAATACCGGTAAATACTGGTGTTTATAACTGATTA AAACCTAATTGTCATAATGATTCTATAAGTATGTTTCTGTGCTTCATTTA GGTCGTTGAGTACTTCTGGGCTATCGGTACTGCTCCATTGTCAACCGACA TCCAAGACTTTGTGTCTGTTGGATTATCTACCAATGCCAGTAACAGTGAC CTGGAGGGTAGTTTGGAACCCCTTCATACCTACTATGCAACTGTCATAGC TGTGAACGGAGCAGGATTGAACACTACAATGAGCACAACAGGTATGAACT TTTACCTTCTTTTTGACATATTCAACGGAAAGTTGAAAGGATGATGGTAG GAGAAACAATCCAATATTTTACCTTCTTTTTGGACACTTAGAACTGCTGC ATAAAGTTGGCCTGAACATGCAGATCTCTTGCACTTTCATTGTAGGTGGC ACAGTTGGAACAATCCCAGGCTCTAAGGCCTGCTAGTGTTGTGGCCATAT CTGATTAATCCTGACACATGATACAAGGCCGGGCGGCCAGATGCAGCGGG ACATTGATTTAAACCTAGAAAATAAAGATAGAAATCACTTTTGAATTATT TCTACTGTAACTGTTGCCGACTTAAGTTGTGCAGTTGTTGTACGATTGCA AGCTGAGGGTATTCTTGGGATTATTAAGTCATGGATGTGTCCTGCAAAAT AGAATTCAATAGTTACTGTCTTGTTATGGTAAAAGTCTAAGATCCTTATT GTCAGTTGGTACTCTCTCAGCAGCCTGTTTGAAACATCTATGGCATCAAA ATCGTATGATATAAACCTACGACAATTGCAACTGTGCCATTAGTGAGACA ACAAAAAAGAGTAGGGGCATGCCCCGGTGTGCGATGGTCCAAACCTTAGA GTCTGGTCTGGGTTGACATCTTTAAAAGGTGAGTCACCTGTTATGTCAAT CCTTCCACAAATGTGGTAAATCTGAATAAATAAAAATAAATAAACTACTA ATCTTACAGGTGTGACCTTCCTCGAGGAATCTCCATCATCAGAAAACGTC ACTATTGGAGTAAAGTGTGAAGAACAAAACGATGGAAGCGAGGTTGATGT GTCGGTCTGTCCTGGCATCAAGTCTTCCGTTGAAGTATCGTGGCCGGACT TTGACAAGCGAGAGGGAATTACTGGCTACTGTGCGTGAAAATTTAATAGC CCTTATTACATTCACAGTATATGATACGACAATGAATCAAAACCTTTAAT AGTGGTATGATTGCAAGTTCTTCCAGTACTATATAAATCAGAGAACTATT TAGAATATGAATTGTCTTGATATTGTTTACCTGGATGTCTAACTTTCATC AACGTATTTATTTCATGATCATTAAGCCATTTACTTTTTATCACTATTGT CACAACATACATGTACATGACTGTATAATGTGCTGTATTGTTTTGTTTTA TCATACATTGTGTTTGGCAGTTCGTAAAATTTTGTTACTTAATTTGGTAA AATTGTTCGATGTATCAATATCATTGTTTGTTTCTCCAGATTTCAGTATT GGTAGTACAGAAGTCTTGGAAGACATCATACCAGAGACGCAGGTTGGGTA CAACGAGTCAGGCACTGTTTTAGTCAAGGATGGACAGATTCTGATTAACG GACGTGTCGTGGCAAACATCTCTGACCTTCGAAACTTGCAAAGTCAAGAC CAAAGTACTCCAAAGATCAACAAATTCAATATGGAACCCGGCAGGTACGT ACAGTTTTATGGAGTCTGATGATGATATTTTGTTTGTTTGTTTGTTTTGC ATAACTGGTAAACTGCCTTTTAATGTATCGCACCAGTTTTGTACAATAAG TACAAGTTGTGTAAGACTGGACTCTGTAAGGCTTGATCCTTTCCTCTTTG CGATAAGTGAGGTGGGATCTTTGACGTGCTCGAGGTGTGGATCTATAATG ACTATGAGATGAAATTATGACAGATGGAAAGCATTGTTTTACTACCTTCA AGTTGGTATAGTCAAACCTGGGCAGGCAACCACCTGTTGCAGGCAACCAC CTGCAGTCACAAGCCACATTAAAACAGTCCCGTCCAATTTCATATAGTCA ACCCCACCCTTTAGCCACCTGTCCTCAACAACCGTTTCTCCGGTCCCTTG AATGGTTGCTGAATCCAGGTTTGACTGTATTTCCATCATGTATATTTCCA TAGTTTCTACATGAATGTATGGCATCAAGGCCTCCTTGATGGCATGAAAT GCAACTAAATCGCATTGCTGAATGTTTCTACAGGAAGATGTACGTAAAAG TGAAGGCATGTAACTCAGCACACAAATGCAGCATTATTGACCTGAAAGTC ATCGTTGTCTCAAGTGAGTGCAAAAAAGTCTTAAATGTATCATTTTTGAA TGTTAGAATCACAAAACTGCAAACGTTATTTCATGCGTATCAAGAAATGT TGAGAAACTTACTAATAAGCATTAAACGGTAAATGTGCATGAAAAACTAT TATACTGTAGGCGAGTCTCATATAATGCTGTTTTTTTCTTTGAGATTTCA TTGTTTTATAGAGATATTCAAAATTGAGCTATTGGTGCTTTTTTTTTACA GGGGAGGGTGATGTAGTTGCCAAGGCTACCAACAGCAGTAAAGTGTCTGT TACGCTGAGCTCATCATCAGCAACTAGGTCTGTTAGAGCCAACGTCAACG AGAGAGTTGTCATTGTGGCTGATGGTAACAATAGTTTGACATGCATTCTT TTTCTTGGTGCACTCAATGCGACAAGTGTATATCACACATTTACATCTTT GGTTATTTGCTTATCATGTATTTGAATCGTATGAGTGTCATAATGGAAAA TATGTATCGTAAAGAACAGCTTCTACTGATGAATCTTCTTAGTTATTCAT CGATAAAACATTGATTTGTGAATCAGATGTAAAGGTCTACTGTTGTAAGC TTTAGAAACAAAGCCTTCTGTTTGGTTGCCATGACGATGATATAAATCTG TACTCCCCACCCTGCAGGTGTTCCTCCTGGTGACGGTCTAGTTGCAGGGA TGTTGAGCAAACATGACGTTGAAGAGGAGTACATCTCCGGTGCTTCCTTA ACATTCACTCCATTCATCGTCGACCCACAAACAACAAAGAACGATTCAGA AAGAAGCTTGAATGGAAGGTAATGTTGTGGTGGACAAAGTTTGTAGAAAT TCCCTCGAGGAATAATGTTATGTATCATTATCTCTTGCTTTGTAATATAT TATAATCATTTTTTTTCTGTAATGTGCTTTGTCCAGTGCCAAAGTAGCTT GCGTAGTCCAGTGATTAGCTGCCCTACCTCTGAACCAGGAGGTTGGGAGT TCGAGTCCCGGCTGTTGTTGCTCTCCTGACTTGCATGCTACTGGAGAAGG TAGCAGTCCTTAGGACGGAATGTTAACTAGACTTATTTATTGTATACCAA GAAAAGAGTTTCCTCAATACATTGAACCTGCAAATACTGTACATAGTGTC TGTCTTCTCTAATCCCAGTGGAAAATTAGCTATTCAGTGAGGTAAGCCGG TTTGAGATCAGTTTCACCTTTGTGTTACAGGTTGAGGGATTTTGCGGAGA GTTTCTTCATCAGTCTTCTCCATGATAAGCCGCTGACAGGACCCCTGGAG ATCACAATCCCAATAAACCCAGACCTGATTCCTGAAGGGACACTACCTGT ACTACTGTTCTGGAGCACTGGTAATTCTTAACCTTCTCCCTGCTGCCTTA CTCTGTGAACAAAAGGGAATTGGGTGCCAAATGGCTGCTTCAGGGTGGTA AAGGTTAAACTTCCTGTAGATATTGATATTATCGCTCTTTCAATGGCACA GAGTAAATGATATACTTTTTCATTAGGTATAGATAGATTACAGGAAGCCT AATGGTCAGAGTGACTTCTAGAATTTTCAGCAGTGCAACTTTCATGTCTG ACATCTAATGTTAGATCTACCTTCAAGTTGGAAGCTTATGACACATCACA AAAAGTTTCACCATTGTCATTTTACTATTCTCAACATCTTTCATCATCAT TCCAGGGTGTTATCACTCCTAGAGAGGAACCCGTCCCTTGGCGGACTCCA GTCTTTTCTTAGTTCTAGTTCATAGTCTGCAAACTCTCTGGTAGGGAGAT CGCGCAGACGGAGTCTCGCAGTTCTTGGCCATACGGGGCCATTGTTGCTT TAAGTTGCTACAGATACAATGTATAATTATGTTTCCTTGTGGTAAGATGA CTGTTTGTGATAGTGGTATTTTACTAGCCTTGAAGGATGACCGTGAATGA TCCACATTATGTTCCAGAGCGTCAGCAGTGGATGGATGCCTCCCTTACCT GTCTCAACTCAGAAAACAACATGGGATATGACTGGGAACAGAACCTGCTG CATGTGAATGTGAGTAAAACTTCAGGTGATTTCTTCTGTTTTAGAAACTG AAGCCCTTGGCGAGTTGTTAGACATTATAAAGTCACATTATAACATAATA GATGAGTTGTGACATTCAGTTAGTCAATAGAAAATTATCAAGTGATAGAT ACTGCAAAATAATTTTGGAAATAAATGCTTTAAAACTCAACATTGCTAAT ATTGAATACAGACAGCTCACGGAAAACAAAATATCATTCTGTGTCTTTCT AGATTCTAAGCCATTTGTTTAAAGAATTTCTAGCTTTTTGAATTTTCCCC AAATATATGTAAGAGTTGTGAGAAAAAAATACAGTACACTGCTGCCATCC CTTGCAGGTGTGTTCAACACATCCCACCAGCAAAACATTAGGGGACAACG TACGCCGCCGTCGTTCAAGCGAAGAAGAGTTCTTTACAGGATCCACACAG TTTGCCGAGTTTTCAGTTGACAGTGACGTAATAAACACCCCGCCTGTCGT CACATCTCCCTCAGCGATGTGGATGTACGAAGACTCAGGAACTCTTAGAG CTCAGCTTCTGGCTCAAGACGCAGAGGGAGACGAACTGATCTTCTCCTTG GACACCGAAGAAGATGTAATGGGAGACGTTGTGCTGAGTCCCGAAGGACT GCTTGAATACACACCATGCCTGCACTGTTTTGGACCTGTTGAAATCAGTT ATGTTGTTCAGGAGAAACCTACAGGACAGACTGCCCCTCTTGAGGTTCGG GTGACTCTTACGATCGACGTGAGGCCGCAAAACGATAACCCAGATCTGCT CTTACTGAGAGACGGCGTCAACGTTGTTTCTGATCAAGGGCCAAATACGT ACAGTCCTGTGGATCTTCCAGTTAAGCAGGGTAACGAACACAGCATCGTC TTGTGGCTGTATGACGTAGACGCTGCAGACGACTTGGTATTCAACGTATC ACAACCACAGTATGGTGCAGTCCAAATTGGACCCATGTGCAAAAAAGTTA CGTTCCTGTCAACACCTTGTAACATGGACAATATCAATGACTTCCACGTA ATCAATGGTAACTGCACCGTCTGTGAACCAGACAATCTGAACACGACCGG TTCCAAAGAAGTAGATGATCTGTCTTGGGCACTAACCAGGTTGACATACA TCTCTAGAAACGAGTCTTTCTTTGGGAAAGACTCATTTGCCATCCACGGT ATAGACGGCAATGGCGGAACGTCAAAGATCTTACGCATCGACGTGTTTGT ACTTCAAAAGTGCCGAAACAACGGAACCTGCATCGGACCTGCTGAAGACC CCGAGTGTAACGACCTGCAGCTGGCCTTTGGATTTGACGGCTATGTCTGT GACTGTACAGAGGGCTTCATTGGAGAATTCTGTCAGATAGAGAGTGGGTT TCTTCCTTTATTTTCCCATATGTACATGTACTGTTAAACCTGGTCAGACA ATCACCTAGCAACCACCTCCAGTCATAAGCCACATCAGAACAGTCCTGTC CATTTTTAAATTTAGCTCACCCCACCCTGTCCTCAGTAACCACCTGGCCT CAAAAACAGATTTCTGCAGTCTGTTGAGTGGTTGCTGAATCCAGGTTTGA CTGTAGTATGATATGTTTAATGGTATCATGCTGTTATTGATGTCAACAGT TTCTGACATTATTGCAATTTGCCGCCACTAGAATAACACTTTTGGTGCAT AAAGGCCGGGGATTATAGTAAAATATCAATTCCTGAAGCTGTAGGGTTGA TGTCAATTAGGATTTTACCACGATGGCCATTGATCGAAGGAGTCCCTATA AAACACGTATGATTGATTGATTTAACAGCATCATACATATGCAGTGAGAA CATGTGTGTGTTACTTCACAGTTGTGCCGTGCTCGCCACCAACTTAATTA TTGAGTAAATGCATCTAAGTTCGCTTGGTTTTTATTTTGTGCTAAGGCGA TAATGGAGTGTTTGCGGTGGTTTTAAGTTTGCAGCAGTGCTATAGTCACA TACATTCATGTACTGCTACAGTATGGACAAAAATGTTTGCAGTGGTTTTA AGTTCAGTCTCCGCAAAAACATTTCTGCATTTACAGTAATGATTAATTGA ATCGTGTGTGTTACTTCCCAGTTGTACCGTGCTCACCACCCACGGCCCCA GTTAACGGAGCGGTGAGTCCTGAAGACTCCACCTCCTACCAGGACGTGGT GGAGTTCTGGTGCGATCCTGGGTACGAGCTGGTCGGTGACTCCGCCCACA TGTGTCACTGGGATGGCAGCTGGAACGGCACCACGCCTTCCTGTGATCGT AAGTTACCTTAATGATAGTTAAGTGAAATAAAGTTAAAGTTCCTAATCAT ATCTTGTTGTACTTCACTCATCATTTTGACACAGAAAATCATACAAAGTT GACACAAAATAGAAAGCCTTGCTCAGAGTGGAAACTCAGTCCAGGATGCT TTTAATGCTGAATATTACATGATAGATTCCAATCATTGTACATGTATAGC ACACATGGAGTTGGAAGTAACAAAAAATGACTAATGCCTACTTCAAGATA TGGTAAAGGAATAGAAAAATGAAGGAAGGACACAAACTTTTATATCTTAT CACATGAACTGGTGGATTGTAATCTATGGCCAAAAAGTTTGAAATCATTT GCTGAGCTGTTTGGTTTCTTCTGTTCCAGCTGTCCCATGCCCAACCTTGT CGGCTCCAGCCAACGGTGCCCTCAGTCCCAGCGGCCCCCATGTCTACCAG GACGTGGTCAACTTCACCTGTTCCGAGGGGTACGTCGTTGCAGGTGTTTC TACCGTCACCTGCCAAGCTGACGGCACCTGGACCGGAAGTGTTCCTACTT GCAAGAGTGAGATAACGTTCTCTGTAATCCTTTATAATTCAAAATTGTTG AATTTAAACCTAACCATGAGCTTTGCTTATAAGTACATGTAGAAGACTGT TGCCAGAAACTGGATGTAGTATGGAATCATGGCAAAGAAAGCAGCGTATT GTCTGGTTGAATTCAATTCAAGTTTTGCTTAAATATGCAGCAAAGCATGT ACCTCCTACTTAGCTCCTACCTAAAAACACTTTGGCAGCACACTCTATGA AAAGATATTGTGGCCAGACTAGCACTAATTTTCAGGCACAAAGAACATGT CAACATACAGAAAAATCATTCGATTTGTAGGCTCTAGTGCATCTGCCATG AAGTCTGTAAGCTTTAAGGGCATAAAAACCTAAAGCATTCACATGAGGTT ACATGTTGTATGTACCTGATTCATCCAAACAGATTCTATTACAAAGTTAT CGGCCAGAAACCCCCAATAAATCACTAATGTATGAGATTGCTTCTTGCAA TCTAAGCCACGATTGCTTAACTTCTGTTTAGTACTTTCTTGCGTNCTGTT TAGTACTTTCTTGCATGAACTTAGCTCCTTTTTTTCAGGTTGTCACGATC AGTACAACTTCCCAGTGGACAAATTTGCCATCTACAAAAACCGTTGCCAC TGGTTCTCACGACAAAAGGATAAAAAAAGGTATGCACAAGCCAAGCGATA CTGTGAGGGCCGTGGAGGGAGACTGGTGACCATCAAGACAGAGGACAAGC AAGCTTTCCTGGAGGGAACTGAGTACATAAAAGTGAAACGTGGAGCGAGA AGGTATGCCTCTCACTTTGGGTAGCTTGTATTGGTTGGTCCAGCCTATTT TCATCGTTTGTCAGCTAAGCATTTTTAAAACTTTTTAAAAGTCGCTATCA CGGTGTTTATATCATGCCCAGACTTTTGTGTTAAATTATTGGCTATTTCT TTTAATATAAATGTAACAAGTTGCTTAGTATTTATGTAACAAGCAATGTC GTTATATCGAACGGGACCGGCCGTTCGAACATAGAACGGCCGATCCCGTT CTCTCATTTGAATAAAACAGTTGTTTGATAGATTTCATCGAGTACGGTTG TGTGCTTGAATTTTCCGACCTCTCATATTTATAGTAATAGTAGTAATGAA TGAGTAATGAATATCATAGATGAATGTTATTTGCATATTTTGCATAGTTT TGGTCGGTGTGTTTGACCACTTGCATGCCAATTTCAACTATTAACAAGCA GTCTCCTGTATCACAATCATCCTGTATTAGCCCGGACCAAGCTAGTCAAG TACAGTGTATTACTTTTTCCAAGTTCTCATATTCGTCACAACATTGCTTG AAACTATTTAATTATTGCATACCATCAGGAACTTTTGGATCGGTTTGGAC GACAAGACGGACGAAAGGACTTTNTTCGTCACAATATTGCTTGAAACTAT TTAATTATTGCATACCATCAGGAACTTTTGGATCGGTTTGGATGACAAGA CAGACGAAAGGACTTTCAAATGGAGTGACAGGACGAATTTGGGTGACTAC AACAACTGGAAATATGCACCAAGAGGTCATAGGAAACGTGACTGTGCAGC AATTCATAGCTCTGACCTTAAATGGGTGTTGGTCAACTGCAACACGAAGA AATTTGCATTCATCTGCGAGATGGGTGAGTGTTTTTCCAAGTTACAGTTG CATGTGATTTGACAAAGATAGTTAAAGCATCATCAAATTCAGATTTGTAT GTTGATCAAATGATCCAAATGATGAACTCAGTTACATGTATAGTAAAAAT AACGTATCCAATAATAAGGAAGGAATTCAAGCAGTTAGGTACCACCATTG ACCTCCTAAGATTTAACACAAAATTCATGATTTATACAAAGATATGCAAA CATTCCAGCTTAATACATGGCTTTGTCTTACATGCTACCAAGTTTTCTTG TTCATCTTCATCATACTATTTACCTGCTATCCCTTAAATTCAATTTTTTT CATGAGTGTACGTGTTTGATGATTTTTTTTTTCTTAGGTCCACATACTAG TTTTTTTACACAGTTCTTTTCATTCTCCAGCAAACTGTCGTTTTTGGCCC CACCTTTCCCATTTTTGTGCAGCTTTAAGTTTAATACAGGAAATGTTGCT TACTTTATAGCAATAGAATGGGCGGCTTTAAGGGTTTTTTTAATCTATTG TTTTCCATTCAGATGACACCATGATCTGAAGACTAGGCTGGACAGCCAAA CGTCGCTGAAGAGAACAGTGCAGGATTTTATAGCTTGGAATCCAGCCTTC TTAGCTTCCGTTGGCTACCCAAGCAGCGGAGCTCGGGTGGCTGACGGAAC CTAAAAAGGCTGGATTCCAGGCTAGGATTTTATGGTTAACGAGGTGTCAT CAATCTTGTTGATCTCTTTCTTTTTATCCTTAAGTAATTAATGCAAGGTA TCATTTGATTACATTTACTTATTTTGATTAAGATTTTTTCATAGATATTT TGATATTATTACCTTAATTTGATTAAGGGAACAATAAGCTAAACCCTTTT GGTTTTATAGATAACATCTTATTTTTGTTAGAAATATTAAATGTTACTTA GATGCTTAGGTCTTAAATTGCTTGCACCTGTTATAAGTGTTCTGCTTGTT CTTCTGTTCAACTTGAACCGTAATTCTTGAGAAGAAGGGAAATGCTTTTT TGGAAGCTGATAGTTTAATGAGAGAGTTGCTTGTTCAGAGCTCGAAATAC TGGATGCATGTGCACTTTTGTGCACCTAAAATTGGAGCTGTGTACCTGAT TTTTTACCGTGGGTGCACCAGTGCACCTGGGTATTTTTGTAGGCTATAGG GTAGAGGTACTATTTTATGTTTAGTTATGAACATATACAGTCATGTAGTG TTCATATACACTTGTCTGGTGGCTTTTAGCACTTGGTGGCTTTGCGGAAT CTAAGAGGGGCTTTTAGAATGAAATTTGAGCATTGCATGAAGTCATAAGA ATGTCTTGAATTTTAATGTAGATACTTAAGTACATGTACATGTTTATTGC CAGCTATCTATAGAAAGGCATAGAATCGGCAATGAAGTAGTTCACAATGA CCGCAAGTTGGAATGCACAGTCATAGGTATGATTAAAATGATATTTTTCT CACTCCGTATCAAATCATGACAACTCTTCCACCATAACTGAAAGGTAAAA GTGTTGGGGGAACTATAGAATTATTGGAGTAAGGGATAAAGCAAAGGAGA TTGGTCTCTTTCTAAAGAGATCACTGCTTTAGAATATCCAGGAAACAATG TATGCCGAACAAAACTGTCAAATGTCATAAGTGTCACTAAACTTATATTA ATATAATGTTACAGCATTTGCTTTTCCAATGAGTGACTGAATTGAAGAAT AAAGGGCTATAAAAGAGGTGACAATCTCCTGTCTTGTTT

Coding sequence (CDS) from alignment at Sc0000014:2373327..2386115+

>transcript:BL96926_cuf8 ID=transcript:BL96926_cuf8|Name=transcript:BL96926_cuf8|organism=Branchiostoma lanceolatum|type=CDS|length=10962bp|location=Sequence derived from alignment at Sc0000014:2373327..2386115+ (Branchiostoma lanceolatum)
ATGTTGAGCAAACATGACGTTGAAGAGGAGTACATCTCCGGTGCTTCCTT
AACATTCACTCCATTCATCGTCGACCCACAAACAACAAAGAACGATTCAG
AAAGAAGCTTGAATGGAAGGTTGAGGGATTTTGCGGAGAGTTTCTTCATC
AGTCTTCTCCATGATAAGCCGCTGACAGGACCCCTGGAGATCACAATCCC
AATAAACCCAGACCTGATTCCTGAAGGGACACTACCTGTACTACTGTTCT
GGAGCACTGAGCGTCAGCAGTGGATGGATGCCTCCCTTACCTGTCTCAAC
TCAGAAAACAACATGGGATATGACTGGGAACAGAACCTGCTGCATGTGAA
TGTGTGTTCAACACATCCCACCAGCAAAACATTAGGGGACAACGTACGCC
GCCGTCGTTCAAGCGAAGAAGAGTTCTTTACAGGATCCACACAGTTTGCC
GAGTTTTCAGTTGACAGTGACGTAATAAACACCCCGCCTGTCGTCACATC
TCCCTCAGCGATGTGGATGTACGAAGACTCAGGAACTCTTAGAGCTCAGC
TTCTGGCTCAAGACGCAGAGGGAGACGAACTGATCTTCTCCTTGGACACC
GAAGAAGATGTAATGGGAGACGTTGTGCTGAGTCCCGAAGGACTGCTTGA
ATACACACCATGCCTGCACTGTTTTGGACCTGTTGAAATCAGTTATGTTG
TTCAGGAGAAACCTACAGGACAGACTGCCCCTCTTGAGGTTCGGGTGACT
CTTACGATCGACGTGAGGCCGCAAAACGATAACCCAGATCTGCTCTTACT
GAGAGACGGCGTCAACGTTGTTTCTGATCAAGGGCCAAATACGTACAGTC
CTGTGGATCTTCCAGTTAAGCAGGGTAACGAACACAGCATCGTCTTGTGG
CTGTATGACGTAGACGCTGCAGACGACTTGGTATTCAACGTATCACAACC
ACAGTATGGTGCAGTCCAAATTGGACCCATGTGCAAAAAAGTTACGTTCC
TGTCAACACCTTGTAACATGGACAATATCAATGACTTCCACGTAATCAAT
GGTAACTGCACCGTCTGTGAACCAGACAATCTGAACACGACCGGTTCCAA
AGAAGTAGATGATCTGTCTTGGGCACTAACCAGGTTGACATACATCTCTA
GAAACGAGTCTTTCTTTGGGAAAGACTCATTTGCCATCCACGGTATAGAC
GGCAATGGCGGAACGTCAAAGATCTTACGCATCGACGTGTTTGTACTTCA
AAAGTGCCGAAACAACGGAACCTGCATCGGACCTGCTGAAGACCCCGAGT
GTAACGACCTGCAGCTGGCCTTTGGATTTGACGGCTATGTCTGTGACTGT
ACAGAGGGCTTCATTGGAGAATTCTGTCAGATAGAGATTGTACCGTGCTC
ACCACCCACGGCCCCAGTTAACGGAGCGGTGAGTCCTGAAGACTCCACCT
CCTACCAGGACGTGGTGGAGTTCTGGTGCGATCCTGGGTACGAGCTGGTC
GGTGACTCCGCCCACATGTGTCACTGGGATGGCAGCTGGAACGGCACCAC
GCCTTCCTGTGATCCTGTCCCATGCCCAACCTTGTCGGCTCCAGCCAACG
GTGCCCTCAGTCCCAGCGGCCCCCATGTCTACCAGGACGTGGTCAACTTC
ACCTGTTCCGAGGGGTACGTCGTTGCAGGTGTTTCTACCGTCACCTGCCA
AGCTGACGGCACCTGGACCGGAAGTGTTCCTACTTGCAAGAGTGAGATAA
CGTTCTCTGTAATCCTTTATAATTCAAAATTGTTGAATTTAAACCTAACC
ATGAGCTTTGCTTATAAGTACATGTAGATGTTGAGCAAACATGACGTTGA
AGAGGAGTACATCTCCGGTGCTTCCTTAACATTCACTCCATTCATCGTCG
ACCCACAAACAACAAAGAACGATTCAGAAAGAAGCTTGAATGGAAGGTTG
AGGGATTTTGCGGAGAGTTTCTTCATCAGTCTTCTCCATGATAAGCCGCT
GACAGGACCCCTGGAGATCACAATCCCAATAAACCCAGACCTGATTCCTG
AAGGGACACTACCTGTACTACTGTTCTGGAGCACTGAGCGTCAGCAGTGG
ATGGATGCCTCCCTTACCTGTCTCAACTCAGAAAACAACATGGGATATGA
CTGGGAACAGAACCTGCTGCATGTGAATGTGTGTTCAACACATCCCACCA
GCAAAACATTAGGGGACAACGTACGCCGCCGTCGTTCAAGCGAAGAAGAG
TTCTTTACAGGATCCACACAGTTTGCCGAGTTTTCAGTTGACAGTGACGT
AATAAACACCCCGCCTGTCGTCACATCTCCCTCAGCGATGTGGATGTACG
AAGACTCAGGAACTCTTAGAGCTCAGCTTCTGGCTCAAGACGCAGAGGGA
GACGAACTGATCTTCTCCTTGGACACCGAAGAAGATGTAATGGGAGACGT
TGTGCTGAGTCCCGAAGGACTGCTTGAATACACACCATGCCTGCACTGTT
TTGGACCTGTTGAAATCAGTTATGTTGTTCAGGAGAAACCTACAGGACAG
ACTGCCCCTCTTGAGGTTCGGGTGACTCTTACGATCGACGTGAGGCCGCA
AAACGATAACCCAGATCTGCTCTTACTGAGAGACGGCGTCAACGTTGTTT
CTGATCAAGGGCCAAATACGTACAGTCCTGTGGATCTTCCAGTTAAGCAG
GGTAACGAACACAGCATCGTCTTGTGGCTGTATGACGTAGACGCTGCAGA
CGACTTGGTATTCAACGTATCACAACCACAGTATGGTGCAGTCCAAATTG
GACCCATGTGCAAAAAAGTTACGTTCCTGTCAACACCTTGTAACATGGAC
AATATCAATGACTTCCACGTAATCAATGGTAACTGCACCGTCTGTGAACC
AGACAATCTGAACACGACCGGTTCCAAAGAAGTAGATGATCTGTCTTGGG
CACTAACCAGGTTGACATACATCTCTAGAAACGAGTCTTTCTTTGGGAAA
GACTCATTTGCCATCCACGGTATAGACGGCAATGGCGGAACGTCAAAGAT
CTTACGCATCGACGTGTTTGTACTTCAAAAGTGCCGAAACAACGGAACCT
GCATCGGACCTGCTGAAGACCCCGAGTGTAACGACCTGCAGCTGGCCTTT
GGATTTGACGGCTATGTCTGTGACTGTACAGAGGGCTTCATTGGAGAATT
CTGTCAGATAGAGATTGTACCGTGCTCACCACCCACGGCCCCAGTTAACG
GAGCGGTGAGTCCTGAAGACTCCACCTCCTACCAGGACGTGGTGGAGTTC
TGGTGCGATCCTGGGTACGAGCTGGTCGGTGACTCCGCCCACATGTGTCA
CTGGGATGGCAGCTGGAACGGCACCACGCCTTCCTGTGATCCTGTCCCAT
GCCCAACCTTGTCGGCTCCAGCCAACGGTGCCCTCAGTCCCAGCGGCCCC
CATGTCTACCAGGACGTGGTCAACTTCACCTGTTCCGAGGGGTACGTCGT
TGCAGGTGTTTCTACCGTCACCTGCCAAGCTGACGGCACCTGGACCGGAA
GTGTTCCTACTTGCAAGAGTGAGATAACGTTCTCTGTAATCCTTTATAAT
TCAAAATTGTTGAATTTAAACCTAACCATGAGCTTTGCTTATAAGTACAT
GTAGATGTTGAGCAAACATGACGTTGAAGAGGAGTACATCTCCGGTGCTT
CCTTAACATTCACTCCATTCATCGTCGACCCACAAACAACAAAGAACGAT
TCAGAAAGAAGCTTGAATGGAAGGTTGAGGGATTTTGCGGAGAGTTTCTT
CATCAGTCTTCTCCATGATAAGCCGCTGACAGGACCCCTGGAGATCACAA
TCCCAATAAACCCAGACCTGATTCCTGAAGGGACACTACCTGTACTACTG
TTCTGGAGCACTGAGCGTCAGCAGTGGATGGATGCCTCCCTTACCTGTCT
CAACTCAGAAAACAACATGGGATATGACTGGGAACAGAACCTGCTGCATG
TGAATGTGTGTTCAACACATCCCACCAGCAAAACATTAGGGGACAACGTA
CGCCGCCGTCGTTCAAGCGAAGAAGAGTTCTTTACAGGATCCACACAGTT
TGCCGAGTTTTCAGTTGACAGTGACGTAATAAACACCCCGCCTGTCGTCA
CATCTCCCTCAGCGATGTGGATGTACGAAGACTCAGGAACTCTTAGAGCT
CAGCTTCTGGCTCAAGACGCAGAGGGAGACGAACTGATCTTCTCCTTGGA
CACCGAAGAAGATGTAATGGGAGACGTTGTGCTGAGTCCCGAAGGACTGC
TTGAATACACACCATGCCTGCACTGTTTTGGACCTGTTGAAATCAGTTAT
GTTGTTCAGGAGAAACCTACAGGACAGACTGCCCCTCTTGAGGTTCGGGT
GACTCTTACGATCGACGTGAGGCCGCAAAACGATAACCCAGATCTGCTCT
TACTGAGAGACGGCGTCAACGTTGTTTCTGATCAAGGGCCAAATACGTAC
AGTCCTGTGGATCTTCCAGTTAAGCAGGGTAACGAACACAGCATCGTCTT
GTGGCTGTATGACGTAGACGCTGCAGACGACTTGGTATTCAACGTATCAC
AACCACAGTATGGTGCAGTCCAAATTGGACCCATGTGCAAAAAAGTTACG
TTCCTGTCAACACCTTGTAACATGGACAATATCAATGACTTCCACGTAAT
CAATGGTAACTGCACCGTCTGTGAACCAGACAATCTGAACACGACCGGTT
CCAAAGAAGTAGATGATCTGTCTTGGGCACTAACCAGGTTGACATACATC
TCTAGAAACGAGTCTTTCTTTGGGAAAGACTCATTTGCCATCCACGGTAT
AGACGGCAATGGCGGAACGTCAAAGATCTTACGCATCGACGTGTTTGTAC
TTCAAAAGTGCCGAAACAACGGAACCTGCATCGGACCTGCTGAAGACCCC
GAGTGTAACGACCTGCAGCTGGCCTTTGGATTTGACGGCTATGTCTGTGA
CTGTACAGAGGGCTTCATTGGAGAATTCTGTCAGATAGAGATTGTACCGT
GCTCACCACCCACGGCCCCAGTTAACGGAGCGGTGAGTCCTGAAGACTCC
ACCTCCTACCAGGACGTGGTGGAGTTCTGGTGCGATCCTGGGTACGAGCT
GGTCGGTGACTCCGCCCACATGTGTCACTGGGATGGCAGCTGGAACGGCA
CCACGCCTTCCTGTGATCCTGTCCCATGCCCAACCTTGTCGGCTCCAGCC
AACGGTGCCCTCAGTCCCAGCGGCCCCCATGTCTACCAGGACGTGGTCAA
CTTCACCTGTTCCGAGGGGTACGTCGTTGCAGGTGTTTCTACCGTCACCT
GCCAAGCTGACGGCACCTGGACCGGAAGTGTTCCTACTTGCAAGAGTGAG
ATAACGTTCTCTGTAATCCTTTATAATTCAAAATTGTTGAATTTAAACCT
AACCATGAGCTTTGCTTATAAGTACATGTAGATGTTGAGCAAACATGACG
TTGAAGAGGAGTACATCTCCGGTGCTTCCTTAACATTCACTCCATTCATC
GTCGACCCACAAACAACAAAGAACGATTCAGAAAGAAGCTTGAATGGAAG
GTTGAGGGATTTTGCGGAGAGTTTCTTCATCAGTCTTCTCCATGATAAGC
CGCTGACAGGACCCCTGGAGATCACAATCCCAATAAACCCAGACCTGATT
CCTGAAGGGACACTACCTGTACTACTGTTCTGGAGCACTGAGCGTCAGCA
GTGGATGGATGCCTCCCTTACCTGTCTCAACTCAGAAAACAACATGGGAT
ATGACTGGGAACAGAACCTGCTGCATGTGAATGTGTGTTCAACACATCCC
ACCAGCAAAACATTAGGGGACAACGTACGCCGCCGTCGTTCAAGCGAAGA
AGAGTTCTTTACAGGATCCACACAGTTTGCCGAGTTTTCAGTTGACAGTG
ACGTAATAAACACCCCGCCTGTCGTCACATCTCCCTCAGCGATGTGGATG
TACGAAGACTCAGGAACTCTTAGAGCTCAGCTTCTGGCTCAAGACGCAGA
GGGAGACGAACTGATCTTCTCCTTGGACACCGAAGAAGATGTAATGGGAG
ACGTTGTGCTGAGTCCCGAAGGACTGCTTGAATACACACCATGCCTGCAC
TGTTTTGGACCTGTTGAAATCAGTTATGTTGTTCAGGAGAAACCTACAGG
ACAGACTGCCCCTCTTGAGGTTCGGGTGACTCTTACGATCGACGTGAGGC
CGCAAAACGATAACCCAGATCTGCTCTTACTGAGAGACGGCGTCAACGTT
GTTTCTGATCAAGGGCCAAATACGTACAGTCCTGTGGATCTTCCAGTTAA
GCAGGGTAACGAACACAGCATCGTCTTGTGGCTGTATGACGTAGACGCTG
CAGACGACTTGGTATTCAACGTATCACAACCACAGTATGGTGCAGTCCAA
ATTGGACCCATGTGCAAAAAAGTTACGTTCCTGTCAACACCTTGTAACAT
GGACAATATCAATGACTTCCACGTAATCAATGGTAACTGCACCGTCTGTG
AACCAGACAATCTGAACACGACCGGTTCCAAAGAAGTAGATGATCTGTCT
TGGGCACTAACCAGGTTGACATACATCTCTAGAAACGAGTCTTTCTTTGG
GAAAGACTCATTTGCCATCCACGGTATAGACGGCAATGGCGGAACGTCAA
AGATCTTACGCATCGACGTGTTTGTACTTCAAAAGTGCCGAAACAACGGA
ACCTGCATCGGACCTGCTGAAGACCCCGAGTGTAACGACCTGCAGCTGGC
CTTTGGATTTGACGGCTATGTCTGTGACTGTACAGAGGGCTTCATTGGAG
AATTCTGTCAGATAGAGATTGTACCGTGCTCACCACCCACGGCCCCAGTT
AACGGAGCGGTGAGTCCTGAAGACTCCACCTCCTACCAGGACGTGGTGGA
GTTCTGGTGCGATCCTGGGTACGAGCTGGTCGGTGACTCCGCCCACATGT
GTCACTGGGATGGCAGCTGGAACGGCACCACGCCTTCCTGTGATCCTGTC
CCATGCCCAACCTTGTCGGCTCCAGCCAACGGTGCCCTCAGTCCCAGCGG
CCCCCATGTCTACCAGGACGTGGTCAACTTCACCTGTTCCGAGGGGTACG
TCGTTGCAGGTGTTTCTACCGTCACCTGCCAAGCTGACGGCACCTGGACC
GGAAGTGTTCCTACTTGCAAGAGTGAGATAACGTTCTCTGTAATCCTTTA
TAATTCAAAATTGTTGAATTTAAACCTAACCATGAGCTTTGCTTATAAGT
ACATGTAGATGTTGAGCAAACATGACGTTGAAGAGGAGTACATCTCCGGT
GCTTCCTTAACATTCACTCCATTCATCGTCGACCCACAAACAACAAAGAA
CGATTCAGAAAGAAGCTTGAATGGAAGGTTGAGGGATTTTGCGGAGAGTT
TCTTCATCAGTCTTCTCCATGATAAGCCGCTGACAGGACCCCTGGAGATC
ACAATCCCAATAAACCCAGACCTGATTCCTGAAGGGACACTACCTGTACT
ACTGTTCTGGAGCACTGAGCGTCAGCAGTGGATGGATGCCTCCCTTACCT
GTCTCAACTCAGAAAACAACATGGGATATGACTGGGAACAGAACCTGCTG
CATGTGAATGTGTGTTCAACACATCCCACCAGCAAAACATTAGGGGACAA
CGTACGCCGCCGTCGTTCAAGCGAAGAAGAGTTCTTTACAGGATCCACAC
AGTTTGCCGAGTTTTCAGTTGACAGTGACGTAATAAACACCCCGCCTGTC
GTCACATCTCCCTCAGCGATGTGGATGTACGAAGACTCAGGAACTCTTAG
AGCTCAGCTTCTGGCTCAAGACGCAGAGGGAGACGAACTGATCTTCTCCT
TGGACACCGAAGAAGATGTAATGGGAGACGTTGTGCTGAGTCCCGAAGGA
CTGCTTGAATACACACCATGCCTGCACTGTTTTGGACCTGTTGAAATCAG
TTATGTTGTTCAGGAGAAACCTACAGGACAGACTGCCCCTCTTGAGGTTC
GGGTGACTCTTACGATCGACGTGAGGCCGCAAAACGATAACCCAGATCTG
CTCTTACTGAGAGACGGCGTCAACGTTGTTTCTGATCAAGGGCCAAATAC
GTACAGTCCTGTGGATCTTCCAGTTAAGCAGGGTAACGAACACAGCATCG
TCTTGTGGCTGTATGACGTAGACGCTGCAGACGACTTGGTATTCAACGTA
TCACAACCACAGTATGGTGCAGTCCAAATTGGACCCATGTGCAAAAAAGT
TACGTTCCTGTCAACACCTTGTAACATGGACAATATCAATGACTTCCACG
TAATCAATGGTAACTGCACCGTCTGTGAACCAGACAATCTGAACACGACC
GGTTCCAAAGAAGTAGATGATCTGTCTTGGGCACTAACCAGGTTGACATA
CATCTCTAGAAACGAGTCTTTCTTTGGGAAAGACTCATTTGCCATCCACG
GTATAGACGGCAATGGCGGAACGTCAAAGATCTTACGCATCGACGTGTTT
GTACTTCAAAAGTGCCGAAACAACGGAACCTGCATCGGACCTGCTGAAGA
CCCCGAGTGTAACGACCTGCAGCTGGCCTTTGGATTTGACGGCTATGTCT
GTGACTGTACAGAGGGCTTCATTGGAGAATTCTGTCAGATAGAGATTGTA
CCGTGCTCACCACCCACGGCCCCAGTTAACGGAGCGGTGAGTCCTGAAGA
CTCCACCTCCTACCAGGACGTGGTGGAGTTCTGGTGCGATCCTGGGTACG
AGCTGGTCGGTGACTCCGCCCACATGTGTCACTGGGATGGCAGCTGGAAC
GGCACCACGCCTTCCTGTGATCCTGTCCCATGCCCAACCTTGTCGGCTCC
AGCCAACGGTGCCCTCAGTCCCAGCGGCCCCCATGTCTACCAGGACGTGG
TCAACTTCACCTGTTCCGAGGGGTACGTCGTTGCAGGTGTTTCTACCGTC
ACCTGCCAAGCTGACGGCACCTGGACCGGAAGTGTTCCTACTTGCAAGAG
TGAGATAACGTTCTCTGTAATCCTTTATAATTCAAAATTGTTGAATTTAA
ACCTAACCATGAGCTTTGCTTATAAGTACATGTAGATGTTGAGCAAACAT
GACGTTGAAGAGGAGTACATCTCCGGTGCTTCCTTAACATTCACTCCATT
CATCGTCGACCCACAAACAACAAAGAACGATTCAGAAAGAAGCTTGAATG
GAAGGTTGAGGGATTTTGCGGAGAGTTTCTTCATCAGTCTTCTCCATGAT
AAGCCGCTGACAGGACCCCTGGAGATCACAATCCCAATAAACCCAGACCT
GATTCCTGAAGGGACACTACCTGTACTACTGTTCTGGAGCACTGAGCGTC
AGCAGTGGATGGATGCCTCCCTTACCTGTCTCAACTCAGAAAACAACATG
GGATATGACTGGGAACAGAACCTGCTGCATGTGAATGTGTGTTCAACACA
TCCCACCAGCAAAACATTAGGGGACAACGTACGCCGCCGTCGTTCAAGCG
AAGAAGAGTTCTTTACAGGATCCACACAGTTTGCCGAGTTTTCAGTTGAC
AGTGACGTAATAAACACCCCGCCTGTCGTCACATCTCCCTCAGCGATGTG
GATGTACGAAGACTCAGGAACTCTTAGAGCTCAGCTTCTGGCTCAAGACG
CAGAGGGAGACGAACTGATCTTCTCCTTGGACACCGAAGAAGATGTAATG
GGAGACGTTGTGCTGAGTCCCGAAGGACTGCTTGAATACACACCATGCCT
GCACTGTTTTGGACCTGTTGAAATCAGTTATGTTGTTCAGGAGAAACCTA
CAGGACAGACTGCCCCTCTTGAGGTTCGGGTGACTCTTACGATCGACGTG
AGGCCGCAAAACGATAACCCAGATCTGCTCTTACTGAGAGACGGCGTCAA
CGTTGTTTCTGATCAAGGGCCAAATACGTACAGTCCTGTGGATCTTCCAG
TTAAGCAGGGTAACGAACACAGCATCGTCTTGTGGCTGTATGACGTAGAC
GCTGCAGACGACTTGGTATTCAACGTATCACAACCACAGTATGGTGCAGT
CCAAATTGGACCCATGTGCAAAAAAGTTACGTTCCTGTCAACACCTTGTA
ACATGGACAATATCAATGACTTCCACGTAATCAATGGTAACTGCACCGTC
TGTGAACCAGACAATCTGAACACGACCGGTTCCAAAGAAGTAGATGATCT
GTCTTGGGCACTAACCAGGTTGACATACATCTCTAGAAACGAGTCTTTCT
TTGGGAAAGACTCATTTGCCATCCACGGTATAGACGGCAATGGCGGAACG
TCAAAGATCTTACGCATCGACGTGTTTGTACTTCAAAAGTGCCGAAACAA
CGGAACCTGCATCGGACCTGCTGAAGACCCCGAGTGTAACGACCTGCAGC
TGGCCTTTGGATTTGACGGCTATGTCTGTGACTGTACAGAGGGCTTCATT
GGAGAATTCTGTCAGATAGAGATTGTACCGTGCTCACCACCCACGGCCCC
AGTTAACGGAGCGGTGAGTCCTGAAGACTCCACCTCCTACCAGGACGTGG
TGGAGTTCTGGTGCGATCCTGGGTACGAGCTGGTCGGTGACTCCGCCCAC
ATGTGTCACTGGGATGGCAGCTGGAACGGCACCACGCCTTCCTGTGATCC
TGTCCCATGCCCAACCTTGTCGGCTCCAGCCAACGGTGCCCTCAGTCCCA
GCGGCCCCCATGTCTACCAGGACGTGGTCAACTTCACCTGTTCCGAGGGG
TACGTCGTTGCAGGTGTTTCTACCGTCACCTGCCAAGCTGACGGCACCTG
GACCGGAAGTGTTCCTACTTGCAAGAGTGAGATAACGTTCTCTGTAATCC
TTTATAATTCAAAATTGTTGAATTTAAACCTAACCATGAGCTTTGCTTAT
AAGTACATGTAG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96926gene:BL96926Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96926_cuf8transcript:BL96926_cuf8-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96926_cuf8-E1BL96926_cuf8-E1-1564476830-120938Branchiostoma lanceolatumexon
BL96926_cuf8-E2BL96926_cuf8-E2-1564476830-120940Branchiostoma lanceolatumexon
BL96926_cuf8-E3BL96926_cuf8-E3-1564476830-120942Branchiostoma lanceolatumexon
BL96926_cuf8-E4BL96926_cuf8-E4-1564476830-120944Branchiostoma lanceolatumexon
BL96926_cuf8-E5BL96926_cuf8-E5-1564476830-120946Branchiostoma lanceolatumexon
BL96926_cuf8-E6BL96926_cuf8-E6-1564476830-120948Branchiostoma lanceolatumexon
BL96926_cuf8-E7BL96926_cuf8-E7-1564476830-120950Branchiostoma lanceolatumexon
BL96926_cuf8-E8BL96926_cuf8-E8-1564476830-120952Branchiostoma lanceolatumexon
BL96926_cuf8-E9BL96926_cuf8-E9-1564476830-120955Branchiostoma lanceolatumexon
BL96926_cuf8-E10BL96926_cuf8-E10-1564476830-120957Branchiostoma lanceolatumexon
BL96926_cuf8-E11BL96926_cuf8-E11-1564476830-120959Branchiostoma lanceolatumexon
BL96926_cuf8-E12BL96926_cuf8-E12-1564476830-120961Branchiostoma lanceolatumexon
BL96926_cuf8-E13BL96926_cuf8-E13-1564476830-120963Branchiostoma lanceolatumexon
BL96926_cuf8-E14BL96926_cuf8-E14-1564476830-120966Branchiostoma lanceolatumexon
BL96926_cuf8-E15BL96926_cuf8-E15-1564476830-120968Branchiostoma lanceolatumexon
BL96926_cuf8-E16BL96926_cuf8-E16-1564476830-120970Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000014genomeSc0000014:2373327..2386115 +
Properties
Property NameValue
Transcript idBL96926_cuf8
Biotypeprotein_coding