Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96925_cuf4 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96925_cuf4
Unique Nametranscript:BL96925_cuf4
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96925_cuf4

>transcript:BL96925_cuf4-protein ID=transcript:BL96925_cuf4-protein|Name=transcript:BL96925_cuf4|organism=Branchiostoma lanceolatum|type=polypeptide|length=307bp
PPELIYLRDGLDPDKDARYSASTTELTANWMFIDEETGVDYLELQVYQKH
GGTRSPIGQSVTLDGGSQNWTSTQPLTLNIGALYTIRVHAINAAGLTAVH
ETDGVLIDPTPPEILFIHAGVLSGMDEELTNSFVVVANTGILAASWLGLD
GESGIDAYWIGLGTTHGGDDVVGFYNVGEVTDIILTELTLNLFENGSPIY
YVSVRAQNGAGAFSTTVTSSPIKVVAADVSGIVFDGAGSKELSEMASTAI
DVDFQLETTTASLHFEGFESAQHGIAAYEWGIGTSPGSDDVQPFTDMGIV
SLEVSGQ
Run BLAST on NCBI

mRNA from alignment at Sc0000014:2353082..2358142+

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96925_cuf4 ID=transcript:BL96925_cuf4|Name=transcript:BL96925_cuf4|organism=Branchiostoma lanceolatum|type=mRNA|length=5061bp|location=Sequence derived from alignment at Sc0000014:2353082..2358142+ (Branchiostoma lanceolatum)
TCCTCCAGAACTGATTTACCTTCGCGACGGCTTGGACCCTGATAAAGACG CACGATATTCAGTAAGTTTTGTTGTTTCCTGTCAGTCATCTAGTTATCAA GATTACCAATTACAACTGAATTGTATTCTGTATAAAGTAGAGTGAACTCA CTCCCCAGCTAACCAACATCTATTGTACCACAGTCATCCCTCAGTAAAGC ATCTGCATGGAGCCGCATAGTTCCTGTTAAGAACTTTTATTGACAGAGGG CAAAACCGGTCTGACAGGCTGAATAAAAGTTCTAAACAGGAACTATATAT ATGCGGCACCAGATGTCTTACTGAGAGATGACTGCAGTGCAATAGATGTC AGTTAGCTTTAAACTGAGTCCACTCCACTTTAAACTGAATTGTATTCTGT TTTGGAAATCTTTTAAAGCTAATCCAAATAATTTTGTATTGATTATTAGG CAAGTACCACAGAGTTGACAGCAAACTGGATGTTTATCGACGAGGAAACA GGTGTGGACTACCTCGAGCTGCAGGTGTACCAGAAACATGGCGGTACGAG GAGCCCTATTGGACAAAGGTTTGTCTGGGGCTTTTTGCTTAAGTTGAAAA TGCACATTGATGAATGTAAACTTTACAGTCATGTGCATTGTAGTGTCCTA CATTTTCCCTCGTATTTAGTTGTATTTTGTTTCTATTGGGGCTTGATATT GACTATTCAACTTGAACATACAACAATCTTTATTGACAACAAAAATACAG CGACTTTCGTAAGGTCTTCTCCCACTATACATGCAAACAGACAATTCGAT ACAAAAGAATTAACCTACGTACATGTACAATTATATGGATAATTCAACAT GTCGAGTTTAACGTGTCACTTACACTGCTGGTTCTTAGGTCTAAACATTC TTTGATATAGTATGGGTAAAAGCATTATGTGTGTTGCACTTATTCAAGCA GTAACTGTGGAAAACCACATCTTATGGTTAATATGTTAATTATATAATTC CAGTGTTACTCTTGATGGAGGATCGCAGAACTGGACGTCAACTCAGCCGC TAACTCTAAATATTGGTGCCCTCTACACCATCAGAGTACACGCCATCAAC GCCGCTGGACTAACAGCAGTTCATGAGACCGACGGTGTTCTTATTGATCC AACACCCCCTGAGGTAATGAATGAAAAATAGGTTGAATATGTAGTTCTTT GCATTGTAGATAAAAGTACATGCACAGACTGGTCAATGATTGTAAAGTTT ACAGTCTAAACCTACACAAGCCATGTCAAAGTAGTTCCATAGATTTTCAT CATACTGACGTACAATCATCAACTACCTTGTTGTAGTGATTAACAATAAC ACAGAGTTGAGTGCAATGAACTAACAGTAACTGTAACCATTTGCTTTGCA TCTCTACTTTACTCTGCTGCTGCTTCTACTGCTCTCCTGCTTCCTCTATC CCTTAGTCCAACTTAATTTGTCCCTAAGGGCACCACAGAAGATCTGGCAA CCAGCTTTCTCCAGTCTTCTCTGTTTTCTGTTTTTCTTAGTGTTTCACTT AGTGTCATGCTATTCTCTGATATTATCGTCCCATCTTTTCCCTTGTCTAC CTCTCTTTCTACTTTACTAAGAAGACAAAAATGTTGATTTTGGATACACA GATCCTATTTATTCATGCTGGAGTCCTCTCCGGAATGGATGAAGAGCTGA CAAACAGTTTCGTTGTCGTTGCGAACACGGGAATCCTCGCTGCCAGTTGG TTGGGTCTGGATGGGGAAAGTGGAATAGATGCCTACTGGATAGGGTTGGG AACTACCCATGGTGAGTAGAAAAAGATATGAAAAGTACACAGTCTGTAAC AAGCTATCATATAAATATAAGCACTCTCTTCAGAGGTATGAGTCTCAAAC CTTGGGCACCTGATCTCAAAAAGTGCTACTCTCCAAGAAGAGGTTAGGCC CTGGCTTGTTTTGGGCGTCTTTTAAAGTGTTTTTTATCTGTCAGGTTTCC TTTTTTCTGCCCAATAAAAATACGCCAAAAGAAGCTGCAGCCTTACCTAT GCTTAAAGAGTAAAAAAGCTGCTGCAATGTACTTAATAAATGCTCATATA GAGCATTTTTATGCAATTGTCATTGCTGTCTACTGCCATGTTGGTGTCCT TATTTGCATTTCAGTGAATCATAGCTCAGATCTTCTGATCCTCTTAAGTA ACCACTAATACATATTTATGTCTACAACTCAAAGAAAAGAATACTAGAAG GAGGCCTATAGAAACTTGACAATGAAACACAAAATTGATGTTAAGGATGA TATGATATGTCAGCTTGAGCAACAATCCATGCAAATACAAATATGGGACA CTAACATGGTGGTCAGCACCTGCCTGCTTCTTTGGAAAATAATTGCAAAT GCTCTATTTGTCTAGTAATATCTTGTTAATACCAATCAACATATTTTATG TTAATACACAGGAGGAGACGATGTAGTGGGATTCTACAACGTAGGAGAAG TAACAGACATCATTCTAACAGAGCTTACCCTTAACCTTTTCGAAAACGGA TCCCCGATCTACTACGTTTCAGTCAGGGCACAGAATGGTGCTGGGGCTTT CTCAACTACAGTGACATCAAGGTAGACCTTAAAAGTTTCATTGACACAAA GGGATAAGATATGTTGTGATTAATCACTCTGCTGTCATTTGTCGAAATCA TGTCTTCCTTTACAACAGTATCACATTATTGCTCTCTTATCTAACAATCT AATCTTATTTTTGCAAGTAATGACTCAGCAACCATGCTGTCTTCTTAATA ATTGAACACTTGATCCTTAACTGTTACTGTAACAGTGAAGTTGACTTTAC TCTAATTCCTCCATTGGTTTGTCATTGTCGGTCAAAGATGTTTGACTTAG AATTCCAATTAGCATTTTTATGATAACCATCATTACGATTTTTGTGCACC AGTCCTATCAAGGTAGTAGCAGCTGATGTCAGTGGAATAGTGTTTGACGG TGCTGGATCCAAAGAACTGAGTGAAATGGCATCTACAGCGATAGATGTCG ATTTCCAATTGGAAACGACGACAGCGAGTCTGCATTTTGAAGGGTTTGAG AGTGCCCAACACGGCATTGCCGCCTACGAGTGGGGAATAGGGACCAGTCC TGGCTCTGATGATGTTCAGCCTTTCACAGACATGGGAATTGTGTCACTAG AAGGTAATCATACAAACATTGATGTACATTGTAGTCTTTGTTTCTGAGCC ACAGAGATATTGTCTTTGCCACTGTGGCTGTATGAGCAAACTGAGAACTA CTTCTTGAATAGGCCAGGTAATCCAATAACAATGTAAGTCTTTTTGTATC TGACCCACAAACTGATAATGTCCATGTGTGACAGCTATATTACATATTCA ATCATGTATATGTATAATGTTAAAGATGGTACTAACGACTGTACTATATG TATATATGTATGACTCAATGTCTGTTTTCTTTGGGCCAAGGATCGTTGAA TCAAAGATTGATGCAGTGGTTTCTTCAATGTTGTTTTTTTTCGTGTTTTT TTTCAACAGAGCCTTCTGGAAGTGGAATCGCTCAGATTCTTTTACCACTT TCCGTGGACATTCACTATTTCTCCAGTGTCAGGGCAATAACTGGGGCAGG AAACATCCTAGAGTCGACGTCAGATGGCTTTGGTGTTGACCAATCGGCTC CTAGCGTTTCAATCATCTCGGTTGGCGAGGAAGATGAGGATGAGGAACAG CAGAAACAAGAGACAGTTTACCAATCAGCAAACGTAGGTAGCTTGTCTGC AGAATGGACCGTAGGAGACAACGAAAGTTCCATTGCGGGGGGGTGGTTTG CCATTGGGTCTTCACCAGCCAGTGCTGACGTGTACAATAGCACGAACACG AACAAGAGAACCAGTCTTCCAGCTGGCCTTCTAACACCTTCTACTGATGG CACTCCAAATATAGTGACTGTGTCTGCAATAAACAAGGTAAGGGTCATGT AACTTACAACTTTTTTTTTTACTTCGATGTAATTGATTATGTTAAGGACA TAATAGATATACCGATACAAAACATTGTAATCAACTGGACTTTATCACTG ATTGTGGCCCTACAATTAGTACAAACGTTAATTTCGCTACTTACATGACC ATTGTTGCTCAGACAGAAAGGCCAGCCAAACACTGCAGCTATGACCAGTA GCTGGTGTCATGGGGTTTGCAGACCAACTTTATTTATTTAAGTATTACAG ACATGACAGATGAGTTTGTAACAGGGCATCCTTTAGATGGTGTATTAGTT TGAAGACAACAAACTGCCAGTGGGAAAACAGATATTTCTCTATCCATTTG TTTGCTTCTATTCATTTGTTTGACTTCTGCAGGTTGGGCTGGTATCCTCG GATGTTTCTCCTCCAGTTGTTTTTGACGCGACTCCACCGGAGCATGTCGA TGACATGGCATGTCCTCAGCACATATCCGGCGAGGTGCCGTTCACATGTA GCTGGGACGGCATCAACGACCAAGAAAGTGGCATTCAACATTACATCGTC AGTGTCGGAGTCAGCGAAGGGGACAATTCCATTGTCAACTCCACGATCAT CTATCCACCAACAAGCCACTTAAGTGTATCAGGTGAATAGAGAAATATTC AATGTATTTCTATCATGTACTGTATCTAACTCTGTATCTCCACAGGCCAA TATATGTAATGCTATGGAAAAACCATGTTTAAATATGAAATACCACACCC CAATTGATATTGTCAGACATCACAGTTGTAAATGTTATTATGATGTTACT TGACTGAACTTATTTTTTACCTTATTACAATTACATGATTATAATCTTGT CAGGCCATAGTAGGTAACTGATAATGTTCAACTATTGTCTTTTTTTAACC ATGACATAGGTTTGAACGAGAGTTTCCTTCAACAAGGAGCAACATTGTAC ACCACCGTGACAGCAGTGAACGGGGCAAATCTTCGCAGCACCAGCTACTC TAGGGCCATTCATGTTGACACGACGCCCCCAGTACTTGGAGTAGTAGTTG AAGTCAATGAC

Coding sequence (CDS) from alignment at Sc0000014:2353082..2358142+

>transcript:BL96925_cuf4 ID=transcript:BL96925_cuf4|Name=transcript:BL96925_cuf4|organism=Branchiostoma lanceolatum|type=CDS|length=6468bp|location=Sequence derived from alignment at Sc0000014:2353082..2358142+ (Branchiostoma lanceolatum)
CCTCCAGAACTGATTTACCTTCGCGACGGCTTGGACCCTGATAAAGACGC
ACGATATTCAGCAAGTACCACAGAGTTGACAGCAAACTGGATGTTTATCG
ACGAGGAAACAGGTGTGGACTACCTCGAGCTGCAGGTGTACCAGAAACAT
GGCGGTACGAGGAGCCCTATTGGACAAAGTGTTACTCTTGATGGAGGATC
GCAGAACTGGACGTCAACTCAGCCGCTAACTCTAAATATTGGTGCCCTCT
ACACCATCAGAGTACACGCCATCAACGCCGCTGGACTAACAGCAGTTCAT
GAGACCGACGGTGTTCTTATTGATCCAACACCCCCTGAGATCCTATTTAT
TCATGCTGGAGTCCTCTCCGGAATGGATGAAGAGCTGACAAACAGTTTCG
TTGTCGTTGCGAACACGGGAATCCTCGCTGCCAGTTGGTTGGGTCTGGAT
GGGGAAAGTGGAATAGATGCCTACTGGATAGGGTTGGGAACTACCCATGG
AGGAGACGATGTAGTGGGATTCTACAACGTAGGAGAAGTAACAGACATCA
TTCTAACAGAGCTTACCCTTAACCTTTTCGAAAACGGATCCCCGATCTAC
TACGTTTCAGTCAGGGCACAGAATGGTGCTGGGGCTTTCTCAACTACAGT
GACATCAAGTCCTATCAAGGTAGTAGCAGCTGATGTCAGTGGAATAGTGT
TTGACGGTGCTGGATCCAAAGAACTGAGTGAAATGGCATCTACAGCGATA
GATGTCGATTTCCAATTGGAAACGACGACAGCGAGTCTGCATTTTGAAGG
GTTTGAGAGTGCCCAACACGGCATTGCCGCCTACGAGTGGGGAATAGGGA
CCAGTCCTGGCTCTGATGATGTTCAGCCTTTCACAGACATGGGAATTGTG
TCACTAGAAGTGTCAGGGCAATAACCTCCAGAACTGATTTACCTTCGCGA
CGGCTTGGACCCTGATAAAGACGCACGATATTCAGCAAGTACCACAGAGT
TGACAGCAAACTGGATGTTTATCGACGAGGAAACAGGTGTGGACTACCTC
GAGCTGCAGGTGTACCAGAAACATGGCGGTACGAGGAGCCCTATTGGACA
AAGTGTTACTCTTGATGGAGGATCGCAGAACTGGACGTCAACTCAGCCGC
TAACTCTAAATATTGGTGCCCTCTACACCATCAGAGTACACGCCATCAAC
GCCGCTGGACTAACAGCAGTTCATGAGACCGACGGTGTTCTTATTGATCC
AACACCCCCTGAGATCCTATTTATTCATGCTGGAGTCCTCTCCGGAATGG
ATGAAGAGCTGACAAACAGTTTCGTTGTCGTTGCGAACACGGGAATCCTC
GCTGCCAGTTGGTTGGGTCTGGATGGGGAAAGTGGAATAGATGCCTACTG
GATAGGGTTGGGAACTACCCATGGAGGAGACGATGTAGTGGGATTCTACA
ACGTAGGAGAAGTAACAGACATCATTCTAACAGAGCTTACCCTTAACCTT
TTCGAAAACGGATCCCCGATCTACTACGTTTCAGTCAGGGCACAGAATGG
TGCTGGGGCTTTCTCAACTACAGTGACATCAAGTCCTATCAAGGTAGTAG
CAGCTGATGTCAGTGGAATAGTGTTTGACGGTGCTGGATCCAAAGAACTG
AGTGAAATGGCATCTACAGCGATAGATGTCGATTTCCAATTGGAAACGAC
GACAGCGAGTCTGCATTTTGAAGGGTTTGAGAGTGCCCAACACGGCATTG
CCGCCTACGAGTGGGGAATAGGGACCAGTCCTGGCTCTGATGATGTTCAG
CCTTTCACAGACATGGGAATTGTGTCACTAGAAGTGTCAGGGCAATAACC
TCCAGAACTGATTTACCTTCGCGACGGCTTGGACCCTGATAAAGACGCAC
GATATTCAGCAAGTACCACAGAGTTGACAGCAAACTGGATGTTTATCGAC
GAGGAAACAGGTGTGGACTACCTCGAGCTGCAGGTGTACCAGAAACATGG
CGGTACGAGGAGCCCTATTGGACAAAGTGTTACTCTTGATGGAGGATCGC
AGAACTGGACGTCAACTCAGCCGCTAACTCTAAATATTGGTGCCCTCTAC
ACCATCAGAGTACACGCCATCAACGCCGCTGGACTAACAGCAGTTCATGA
GACCGACGGTGTTCTTATTGATCCAACACCCCCTGAGATCCTATTTATTC
ATGCTGGAGTCCTCTCCGGAATGGATGAAGAGCTGACAAACAGTTTCGTT
GTCGTTGCGAACACGGGAATCCTCGCTGCCAGTTGGTTGGGTCTGGATGG
GGAAAGTGGAATAGATGCCTACTGGATAGGGTTGGGAACTACCCATGGAG
GAGACGATGTAGTGGGATTCTACAACGTAGGAGAAGTAACAGACATCATT
CTAACAGAGCTTACCCTTAACCTTTTCGAAAACGGATCCCCGATCTACTA
CGTTTCAGTCAGGGCACAGAATGGTGCTGGGGCTTTCTCAACTACAGTGA
CATCAAGTCCTATCAAGGTAGTAGCAGCTGATGTCAGTGGAATAGTGTTT
GACGGTGCTGGATCCAAAGAACTGAGTGAAATGGCATCTACAGCGATAGA
TGTCGATTTCCAATTGGAAACGACGACAGCGAGTCTGCATTTTGAAGGGT
TTGAGAGTGCCCAACACGGCATTGCCGCCTACGAGTGGGGAATAGGGACC
AGTCCTGGCTCTGATGATGTTCAGCCTTTCACAGACATGGGAATTGTGTC
ACTAGAAGTGTCAGGGCAATAACCTCCAGAACTGATTTACCTTCGCGACG
GCTTGGACCCTGATAAAGACGCACGATATTCAGCAAGTACCACAGAGTTG
ACAGCAAACTGGATGTTTATCGACGAGGAAACAGGTGTGGACTACCTCGA
GCTGCAGGTGTACCAGAAACATGGCGGTACGAGGAGCCCTATTGGACAAA
GTGTTACTCTTGATGGAGGATCGCAGAACTGGACGTCAACTCAGCCGCTA
ACTCTAAATATTGGTGCCCTCTACACCATCAGAGTACACGCCATCAACGC
CGCTGGACTAACAGCAGTTCATGAGACCGACGGTGTTCTTATTGATCCAA
CACCCCCTGAGATCCTATTTATTCATGCTGGAGTCCTCTCCGGAATGGAT
GAAGAGCTGACAAACAGTTTCGTTGTCGTTGCGAACACGGGAATCCTCGC
TGCCAGTTGGTTGGGTCTGGATGGGGAAAGTGGAATAGATGCCTACTGGA
TAGGGTTGGGAACTACCCATGGAGGAGACGATGTAGTGGGATTCTACAAC
GTAGGAGAAGTAACAGACATCATTCTAACAGAGCTTACCCTTAACCTTTT
CGAAAACGGATCCCCGATCTACTACGTTTCAGTCAGGGCACAGAATGGTG
CTGGGGCTTTCTCAACTACAGTGACATCAAGTCCTATCAAGGTAGTAGCA
GCTGATGTCAGTGGAATAGTGTTTGACGGTGCTGGATCCAAAGAACTGAG
TGAAATGGCATCTACAGCGATAGATGTCGATTTCCAATTGGAAACGACGA
CAGCGAGTCTGCATTTTGAAGGGTTTGAGAGTGCCCAACACGGCATTGCC
GCCTACGAGTGGGGAATAGGGACCAGTCCTGGCTCTGATGATGTTCAGCC
TTTCACAGACATGGGAATTGTGTCACTAGAAGTGTCAGGGCAATAACCTC
CAGAACTGATTTACCTTCGCGACGGCTTGGACCCTGATAAAGACGCACGA
TATTCAGCAAGTACCACAGAGTTGACAGCAAACTGGATGTTTATCGACGA
GGAAACAGGTGTGGACTACCTCGAGCTGCAGGTGTACCAGAAACATGGCG
GTACGAGGAGCCCTATTGGACAAAGTGTTACTCTTGATGGAGGATCGCAG
AACTGGACGTCAACTCAGCCGCTAACTCTAAATATTGGTGCCCTCTACAC
CATCAGAGTACACGCCATCAACGCCGCTGGACTAACAGCAGTTCATGAGA
CCGACGGTGTTCTTATTGATCCAACACCCCCTGAGATCCTATTTATTCAT
GCTGGAGTCCTCTCCGGAATGGATGAAGAGCTGACAAACAGTTTCGTTGT
CGTTGCGAACACGGGAATCCTCGCTGCCAGTTGGTTGGGTCTGGATGGGG
AAAGTGGAATAGATGCCTACTGGATAGGGTTGGGAACTACCCATGGAGGA
GACGATGTAGTGGGATTCTACAACGTAGGAGAAGTAACAGACATCATTCT
AACAGAGCTTACCCTTAACCTTTTCGAAAACGGATCCCCGATCTACTACG
TTTCAGTCAGGGCACAGAATGGTGCTGGGGCTTTCTCAACTACAGTGACA
TCAAGTCCTATCAAGGTAGTAGCAGCTGATGTCAGTGGAATAGTGTTTGA
CGGTGCTGGATCCAAAGAACTGAGTGAAATGGCATCTACAGCGATAGATG
TCGATTTCCAATTGGAAACGACGACAGCGAGTCTGCATTTTGAAGGGTTT
GAGAGTGCCCAACACGGCATTGCCGCCTACGAGTGGGGAATAGGGACCAG
TCCTGGCTCTGATGATGTTCAGCCTTTCACAGACATGGGAATTGTGTCAC
TAGAAGTGTCAGGGCAATAACCTCCAGAACTGATTTACCTTCGCGACGGC
TTGGACCCTGATAAAGACGCACGATATTCAGCAAGTACCACAGAGTTGAC
AGCAAACTGGATGTTTATCGACGAGGAAACAGGTGTGGACTACCTCGAGC
TGCAGGTGTACCAGAAACATGGCGGTACGAGGAGCCCTATTGGACAAAGT
GTTACTCTTGATGGAGGATCGCAGAACTGGACGTCAACTCAGCCGCTAAC
TCTAAATATTGGTGCCCTCTACACCATCAGAGTACACGCCATCAACGCCG
CTGGACTAACAGCAGTTCATGAGACCGACGGTGTTCTTATTGATCCAACA
CCCCCTGAGATCCTATTTATTCATGCTGGAGTCCTCTCCGGAATGGATGA
AGAGCTGACAAACAGTTTCGTTGTCGTTGCGAACACGGGAATCCTCGCTG
CCAGTTGGTTGGGTCTGGATGGGGAAAGTGGAATAGATGCCTACTGGATA
GGGTTGGGAACTACCCATGGAGGAGACGATGTAGTGGGATTCTACAACGT
AGGAGAAGTAACAGACATCATTCTAACAGAGCTTACCCTTAACCTTTTCG
AAAACGGATCCCCGATCTACTACGTTTCAGTCAGGGCACAGAATGGTGCT
GGGGCTTTCTCAACTACAGTGACATCAAGTCCTATCAAGGTAGTAGCAGC
TGATGTCAGTGGAATAGTGTTTGACGGTGCTGGATCCAAAGAACTGAGTG
AAATGGCATCTACAGCGATAGATGTCGATTTCCAATTGGAAACGACGACA
GCGAGTCTGCATTTTGAAGGGTTTGAGAGTGCCCAACACGGCATTGCCGC
CTACGAGTGGGGAATAGGGACCAGTCCTGGCTCTGATGATGTTCAGCCTT
TCACAGACATGGGAATTGTGTCACTAGAAGTGTCAGGGCAATAACCTCCA
GAACTGATTTACCTTCGCGACGGCTTGGACCCTGATAAAGACGCACGATA
TTCAGCAAGTACCACAGAGTTGACAGCAAACTGGATGTTTATCGACGAGG
AAACAGGTGTGGACTACCTCGAGCTGCAGGTGTACCAGAAACATGGCGGT
ACGAGGAGCCCTATTGGACAAAGTGTTACTCTTGATGGAGGATCGCAGAA
CTGGACGTCAACTCAGCCGCTAACTCTAAATATTGGTGCCCTCTACACCA
TCAGAGTACACGCCATCAACGCCGCTGGACTAACAGCAGTTCATGAGACC
GACGGTGTTCTTATTGATCCAACACCCCCTGAGATCCTATTTATTCATGC
TGGAGTCCTCTCCGGAATGGATGAAGAGCTGACAAACAGTTTCGTTGTCG
TTGCGAACACGGGAATCCTCGCTGCCAGTTGGTTGGGTCTGGATGGGGAA
AGTGGAATAGATGCCTACTGGATAGGGTTGGGAACTACCCATGGAGGAGA
CGATGTAGTGGGATTCTACAACGTAGGAGAAGTAACAGACATCATTCTAA
CAGAGCTTACCCTTAACCTTTTCGAAAACGGATCCCCGATCTACTACGTT
TCAGTCAGGGCACAGAATGGTGCTGGGGCTTTCTCAACTACAGTGACATC
AAGTCCTATCAAGGTAGTAGCAGCTGATGTCAGTGGAATAGTGTTTGACG
GTGCTGGATCCAAAGAACTGAGTGAAATGGCATCTACAGCGATAGATGTC
GATTTCCAATTGGAAACGACGACAGCGAGTCTGCATTTTGAAGGGTTTGA
GAGTGCCCAACACGGCATTGCCGCCTACGAGTGGGGAATAGGGACCAGTC
CTGGCTCTGATGATGTTCAGCCTTTCACAGACATGGGAATTGTGTCACTA
GAAGTGTCAGGGCAATAA
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96925gene:BL96925Branchiostoma lanceolatumgene
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96925_cuf4-E1BL96925_cuf4-E1-1564476830-120916Branchiostoma lanceolatumexon
BL96925_cuf4-E2BL96925_cuf4-E2-1564476830-120918Branchiostoma lanceolatumexon
BL96925_cuf4-E3BL96925_cuf4-E3-1564476830-120920Branchiostoma lanceolatumexon
BL96925_cuf4-E4BL96925_cuf4-E4-1564476830-120922Branchiostoma lanceolatumexon
BL96925_cuf4-E5BL96925_cuf4-E5-1564476830-120924Branchiostoma lanceolatumexon
BL96925_cuf4-E6BL96925_cuf4-E6-1564476830-120926Branchiostoma lanceolatumexon
BL96925_cuf4-E7BL96925_cuf4-E7-1564476830-120929Branchiostoma lanceolatumexon
BL96925_cuf4-E8BL96925_cuf4-E8-1564476830-120931Branchiostoma lanceolatumexon
BL96925_cuf4-E9BL96925_cuf4-E9-1564476830-120933Branchiostoma lanceolatumexon
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96925_cuf4transcript:BL96925_cuf4-proteinBranchiostoma lanceolatumpolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000014genomeSc0000014:2353082..2358142 +
Properties
Property NameValue
Transcript idBL96925_cuf4
Biotypeprotein_coding