Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96923_cuf21 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96923_cuf21
Unique Nametranscript:BL96923_cuf21
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96923_cuf21

>transcript:BL96923_cuf21-protein ID=transcript:BL96923_cuf21-protein|Name=transcript:BL96923_cuf21|organism=Branchiostoma lanceolatum|type=polypeptide|length=1224bp
GGCHNLCLLQPGGKRTCACAENFYLASDGKTCLSNCTSSQFECGNFKCIP
FWWRCDTENDCDDGSDEPESCPPFVCRPGQFQCNNSECTNPAFICDGDQD
CTDGSDEKNCEHHTCLPNQFKCKGENKCIPGIFRCNGATNCQDGSDEQKC
PERTCAANQFKCNSSKICIPRVWMCDGDNDCGDGSDEPNNCTARSCSDNE
LRCNNTGRCIPARWQCDGDNDCGDGSDEQVGVCSARTCDQYQHRCNNNKC
IPARWRCDYDDDCGDNSDEDGCTPRPCSESEFQCDDNRCIPGRWKCDGDH
DCENGSDESGCSATCLPNQFQCRNGHCIPQGWHCDLDRDCLDGSDEDNCE
TSESPGVLCNEGEFQCNNTLCKPLSWKCDGEDDCGDKSDEEAFMCKNFVC
PPTRQFRCRNDRVCLPISRRCDGFSHCDDNSDEIDCRAPAENRTCTADDF
KCLSGNRCVKLDLVCNNYDNCGDGSDEGLCGPPNVNECQTNNGNCQHMCT
DLPRGHYCTCRDGYTLGDDLTTCEDIDECADFGRCSQICTNTKGSYHCSC
SAGFTKAQRSNGVATCIAEGDPDYLLIADDNAIKRINPDNIRDGSGDGYR
GNDNTRVESMDIDVKSGTAYWSNIHTSSIYKATIQLGNGRKKRQATDIAK
LDIHGLEEPRGIAIDWVGRHIYWTDARKDALEVANLNGTNRKTLLSTGMD
RPHSVAVDPKNGYVFWTDWGLSPKIERARLDGLERRVLVREDLQWPTGLA
IDYQNRRLYWADAKKNTIESIDFDGNGRVVAANYSKGLHQPYLIDLFEDN
IYGTTYLTGEVFKVDKFGRDNVTVLANNLQHASDVVIFQQHKQDQTITNP
CSSSNCTHLCFRAPMPGGGTICACPNGGNLDGNSCLNVPTPSPTGPTTTA
CDQAGIICYNAGTCITNEKGDPKCKCHPNFHGPQCRLNKCYRYCANNGRC
QLNSLEKPVCTCVGEFFGPRCNSSCDNYCQNGGTCSVRGNRGVCDCPLPY
GGDRCETNLCDDRCKNGATCTVLSGSITCVCPENFHGPQCESTTNLCFDF
CQNGGKCSLDDNNQPVCACLKGFEGQQCTETVPSTKGERKGEGGDGGTTA
AIVVPVVLALIIIAVICGVCFYRKRSSRTMFQHKRMTNNVEIGNPTFLYD
QEEDDETEQLDPSLTLDPDKPTNFSNPVYDCLYNEASGSSNSLTSTEEKK
GLLSPSGIQLYEDQNDPFGGSSVA
Run BLAST on NCBI

mRNA from alignment at Sc0000014:4099497..4127675+

Legend: polypeptideexonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96923_cuf21 ID=transcript:BL96923_cuf21|Name=transcript:BL96923_cuf21|organism=Branchiostoma lanceolatum|type=mRNA|length=28179bp|location=Sequence derived from alignment at Sc0000014:4099497..4127675+ (Branchiostoma lanceolatum)
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA ACCTGAAAGCTGTCGTAAGTAGACTTCATACAAATGTAGATTTTACTGGT ACAGAAGAGGTAGAGACTACAGTAACTGGTAGAGACTACAGTAACAGAAG CAGTCTTTCAAATTACTTCATACAAATCGACAGTCGTCGGACAATCCTGT AAATTGTCGTAAGTAGACTATATAAAGTTTAGCAACAGTTATAACTACAG AAATGATAAAGACTATTGGTACAGAAATCTTCTTTCAAATTACCTTGCTG TACTTGCTGTCCTATCTTATTTTTCAAAACAAGCCAAGAAGCACTTCTAT CATTGCAATGCCATGATAACAACAGCATATTGGATTATCATTTGATGATA ATGATGTTATCATTTGATAACAGTTATATAGATACCAATATAATACAATG TAGTTGCAGGGATACTTTTTTGTCATAAAGGTTTCTGTGTGATGGTGAAG CACTCCACTGCAGTATGTAGTACATTGCATATGAAAAAATAGTATGAAGC GTGTACATTTCACCTACAATGGATCACTGGAAGAATTATAGATTTTTCAA AACTAAAACAAGATCTCTTTTATTGTGGTAAACTACTGTTATACCAGCAC GCTTTTAAAACTTCTGAGTTTGATGATGGTTTATGTTGTTTCCATGTAGC GCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTA CCAACCCTGCCTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCC GATGAGAAGAACTGTGGTAAGGGCCTAGTCACATTTGCTTTATGATCGTT GAACGCTCGAAAGCTGATTGTATTCTATAGGGATAGTCGTGAATGTGACA TACAAAATTCATTAGTCTTCTTAATAAAAATGTTGTCATAGATGCTTTGG CGGTGGTTGGTTCTGTCACAGCCTGCTTGAAAATATAACAACATCAAAAT TGTATGACGACCCACAACGAAAGTGACCGCGCCATAATGCAACATCTCAA CTCACCTCTAACATTACTTGACAATGTGTCACTATGTGCTGACCGCTGAT GTAATATCATTTGGTTACATAAATCTGCCGCTTTGAAAAATAGTGGGTTT GACAGATTGCTAGTGCAGCACCCCCCAGGTATGCACGGTTGAGATCTACA GGAGTGCATTATACTGGGGGATGTTCGGTTGGAGATCTGTTGGGACGTAT CTTTTCAGGGTGGCAGAATTATGTACCCTGGTGGAATTATGTTAGTAGAT GCTACATGTATCTCTTAATAGCATTGATCCAATGCTAATTGTTATTCCAA TGGCGGTGGCACAGTGGCAGGGTGTTTGGCCCCAGAACCCAGAGATACCG GGTTCGAATCCGGGGTTCCCCGATTTGTCCCGTTGACGTTGTGCCCTTGG AAAAGGCACTTTACACAACTTTCCCCACTTTACTCAGGTGAAAATGAGTA CCTAGCTTCGGTTAGGGACGTCCTTCGGGTAGGACGTTAAACGGAGGTCC CATGTTTGAGGAGAGCAACACCTCAAGCACGTTAAAGAACCCAACACACT TATCAAAAAGAGTAGGGGTCCTTACCGGTGTGTGTGGATCATATAAATCC GTCCGGATATGCAGCTTGTACTCCTCAGTACAAACCTGGTGTGTTACGCC TTGATGCGGTTTACCGAGTATGCAATACAAACAAACAAATTCTTTTGTCT GCAGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAGAA CAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCAGG ATGGTAGCGACGAGCAAAAATGTCGTAAGTAATCATACCATAATTATGAT ATGATCACTTCGTCTAGGTACAAAATTTTCAGAAAACTGGACATGATATT ATAAGTTTGGAAATCAATTTTTGTGAGACTAGGCACTTTGTGTTTTTAGA ACAATTTTAGGGATTCGAATTGTTTAAGTGCAAATTGAAATATTGCAACT GATGTAGAGATGTAAATTGACAGCAGACATAAGACACTATGCATTGTTGC AAGCAATTTCGGGGATTGGGATTGTTTAAATGAGTGCCTAAAATATCTCA ACCAAAAGCAAATTGACAGCATTTGAAACCAATCATGGCAGAATGAAGCA TCTTTGAAACAATACTTTTTGTCAGTCCTAAGAGCTACACATCTAGAAAA AACTGTGACTTATTATTGTAACCAAGTGCAAACGCACATGAGCAGGGGAA AACCACCCTGAATTGTAGAGTTTGCTTACAATTTTAAAAAATGAATGTTG TTTGATGTTGGAATTATAGCTAAGATGTTGTTTGAAGCCAGTCTTAGATT GTTCTACACTGTCTATACTACAAACTGTTACATACAGATTATGAAGTTAC TAAGCATACATGTAAGCATTATAATAACAGAGATTTTTCCCTCTTAGCTG AGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGATCTGT ATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACGGCTC GGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAACTAC GCTGCAACAACACAGGTATGTACCATCTCAGCTGGTTACCTTTTGTGACT GCTAACAGTGTAGGTAGCATGCATGCGTAGTCCAGTGGTTAGCGATCTTG CTTCTGGAACTACAAGCCGTGAGTTCAATCTCGGCTGTGTTGCTCACCCG ACATGCACGCTACCGGAAAGGGTTGCAGTCCTTAGGACAGGACGTTTAGC CGTGGTCCACTGTTCATTGTGCTTGTCGAAAAGAGCTAGGGGAATTTCCC CGGTACAATGAACCTGTAGATACTGTAAATAGTGTCTTCTCTCTCAAGAC CAGTAGAAGATGAGCTCTTCAGTGATGAACTTAACTGGATTGAGATCATT TTCCTTCCCTTAACATGTGAGGTGCATAGTCCAGTGGTTAGTGACTGTGA AAAGCCAACAAAGAAATTGGACTTACACAAATTTTCAACTGATCAATTCA CTGCTTCAGAACAGATAGAACATGTGACTCGGTGAGCAGTGGACAAAACT AGAGAATGAACAGAACTTTGCAGTTTGTCATAGCTTGTAATGATAGATAT TTTTGTTTGTTTGTTTGTTGACTTGTAAACACTGTTGTTCTACCACCCTA GGTCGCTGTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGG GGATGGGTCGGATGAGCAAGTCGGTGTCTGCAGTAAGTCACTCTTCCTTC TTCATATTTCCAGTGGCAGATGGAAAAGTTGCAGTTCATTCTGAATGTGA CTATGTCCAAGAACAGACCATGCAATATCTATTAGTCTGCACTCTTTTAC CGCAACCCAGGCTGACATGGTAAAGTGTATCAACAGAAGTTCCGGTGCCA AATTACATGTATATGGGTGGGAAAGTGAAGATGAATTAGATTAAGAAATC TTTGCCCTAGGTCCCTTTTTTACAATACTGTAGCAAGCCATTTCTGGCCT GTCCCCCATCCCTAGGTGGATCTCTATAGTTGGTCCAAGAAATCACACAC GGACAAGGCTTCCTACTCCATGTGCATCTTGCATCCTGCATGTAATCCTG ATCATTTGGTTCAATCTTGTATGTGACCTCTCTAAGAGAGGTCACTGGAT AAGTCTATTTCACTAGGAGGGGGTATGATCTACTATGGACTCTACAATGC TCAAAGGAATTGGGTCATTTGCTAGTAAACTGAACCAGTGCATACTGCAC GTAGTGCTGGTTCTTTGTCTAATGATGAGAAGGGGAAGTCTTGATTTAGC GTAAGCTGAGGTTTGGGAAAGACAGATGAAATTTGACATTTTCTACATGT TATATTAGGTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACA ACAAGTGTATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGA GACAACTCTGATGAAGACGGCTGCAGTAAGTATCTGGGATCATACAGAAT GTCGAGGTTGATTTATATGTTTTTTTGTACTTTTGAACTGCTGTGAATGG CAACACACTGTTTTCTTCTTGGGATAAGTCAGTTGCTATTACAGTTGTGC CCTAGTGCGAAATCCTTCACACATTTTCACAGCGGAAGTTGTTCCCCTTA CAAATGGATACAACTGCAAAGCTATGGATTTCCTCCTGTTATAGGACATT GTATTGTGATAGGCATTGATTATTTTTTGGAGCCTGGAACCACGAAAGAA GCTGTATAGGTGAAACCAGTCTGGATGACAGGCTGAATTAAAATTATAGA TTGATGGGAACTATACAGATGTCTTGGATGCTCGCAATATATACTTTAAT CATGATAGGCATATAGCATCGTCATTGTTGGAATGGTAAGGGGAAAATTG AATTGTTTATCATCACTATATTTTAAGCACCACGGCCATGCTCAGAGAGT GGGAAAGATGTTGGTTACCTGAGGATTTAGCCACTCTCAGTGTATGATTA TCGTGATAGGCATATAGCATCAATGATGCCAGAATGATAAAAGAAGATTG AATTGTTTATCATGGCTCTATTTTCAGCACCTCGACCATGCCCTGAGAGT GATTAAGATGTTGGTTAGTTGAGGATTCACCCACTCATAATCATGATAGG CATCAGTATTGTTGGAATTGTAAGGGAAAACTGAATTGTTAATCATCACT CTACTTTCAGCACCGCGGCCATGCTCTGAGAGTGAGTTCCAGTGTGACGA CAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCATGACTGTG AAAACGGTTCAGACGAAAGCGGCTGCTGTAAGTTTCTGTTAATTGTGTTG AATTGTGTGATACTTTTTGCCAAAGGCTAGTCTTCCAGGGTTGAATCGAG GATCAAAAAATGCATTTTGCTTCGCTGTTCAAAATCCTGAAGTCAAGCTC TATCTGAGTATGGTGCTTGTTGACAACAAAAGGATGAGGGAGGGAGAGAG AAATAATGGAATGTAGGATTAAGTTTGAATGTTGCTGTACTTTATAACAT CCTATGATCTAGTTCTATCAAATGTAGAACTTGTAAAGAACTACGTGTAT AGGACAACCCAGAAAAAGGAGGGAAAAGAAAGAAAGGAAATAACAAAATC AAAAGTAAACACAGACTAAGGGATGGAGGGTTGATATGAAAAAAGCACAA AAGATAGGAATTTAGTAACTGAGGTATGCTTAAAATGACCACTAAAGGGT TAAACTTAAAGTTTAGGAATAAAGAGAAGGAGGGATTGCAATGAAGGAAA TGGATAAGAGGAATCTTAAAGTTTAACCTCCTTGCTGCCAATACAAATTG GTGCCAAATGGCTGCCAAATGGCTATCATAGCAAGAATAGGGTTAAAGGG AGCAATTGAAAAAGCTATATACATTTAAATTCTGGTTGTTAGAAATGTTT TGCATTTGTACATTGTTTTATGCTGGTGTTTTTTGCTTCCACAGCGGCTA CCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAG GGCTGGCACTGTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGA CAACTGTGAAACATCAGGTTAGTTTCTTATACAAAGGTCTTAAACATTCT CCTTGTGGTGAAATGATGTCATTGTAGGTTGTGACCAAGGGGCACATATT TTTCTGTCAATTAAAAAAATGCAAAACTGTTTTGTTTTAACATCCGTGAA TAGTTTCATCAGGTTGGTAAGACACTGAATAAAAAGACTCTTTTTACACA ACCAAGGGATTTATTCAACCGACGTTTCGGTGACCCTCTGTCACCTTCTT CAAGGCAATTCTGACTGGTTCACATAGCAATGCAGCACAGGTGTTGCTGC TTAATAATATACATAACTTCATGATTAAGCTTTGCTTTGCTTAACCATTC TGGAACAATAACGATGTCACTCAATGTCTATTCTTTTTGGTTCTCTGGTG GCTATTCAATCCAATAAGGGCTGCCAGCTCTGGTCCAAATACAAGATTAT TATTTGAAAAAAAATCTTTATTCAATTATTGATTAATACATAGCAAAACA GCACATTTACAATTTCACAGATATACACACACTGTCAGTTACATATTGTT ACAGAGGCCATTCCCACTGTTTTTTTTGGCTAGGGTGTGCTCCCATACAA GATTATGACAAAGCAGCTATTGGAATCAAATTCAAAATGTTCCCTTTTCC TCCCTAGTTACAGGGTGAGTTTATACACAATTCACTTACGATGTGTGATG TTTTATGTTCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAG TGTAACAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGA CGACTGTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAGTAAGTCAT GCCTCAGTTCTTACTAAGCGTCATAACGTAGTGTTCCATGCTAAGGATAG ACTAGACTAAGGATATTAAAATGGGTTGTATTAGGAGTATTTTACGCCCA AAATAATTACTCAAGCAACTATTTCAAAATCTTATCCAATTGCTTGTCAA AAATGAGTTATTAGTATTATTTTTGCCGTATCTTTTTACCTGGATATCTA ATCTTCATCAATGTACAAAATGTATGGCCTATTTTAGTTGCATTTCTTGG CCTTAAAGCAACAAATTTTTGACATTACATCAGTTTTGGAAAATATGAGA CTACATGTAGAATCGATATCTAGATGTCTGAAGGAAAAGACTTGTACTGT GCTTTTCTTTAAGCTAGTGATTCAAATTTCTAAAACTTATTAATATATTA TATAATAAACAGTCTGAAAATGCCGTTTAGCTTCTGTGTAGTCAAGTTCT TAAATTTGATATGTAATGCAGACATTAAGGCAGGGAGTTGTCCTTTTCTT TGAAATTATTGTTATTTTGATATTAAACTGTATTGTGCTGTTTTTGTTGT TGCAGAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCCGTAACG ACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGCCACTGT GACGACAACTCCGATGAAATAGACTGCAGTAAGTATCGTCTTACAATCAT ACAACACCTCTCTTAATGGTTCAGTTGGAACTGGGAAGTCTTTACGTTTG TGCCCAGATTAGCGAAATGTTCAATTTGTTTGATATCCCGTTATAGTAAT CCATCAATCCATTTTTTCTTATTGTTCAAACTGAAGTAAGACTCTTCTTG CTTTTGCTTTTCAGAATAACATTTTTACCTGTAATTAGATGGCCATTTTG TTTTATGTGATTATTGTGAAGGATTAGATGGAAAGATATGCAAACATGCA CTGACAGGTAGTAATAAGCTTTGTTTTGTGATCCACATTTTTGTGCTTAC TTGCAGTTTGGAAGTAATAATTTTTTTGTTTGTTTTGAAGTAGCTCGTTC TTAGAAGAAATTCTATCTTTTAATCTGTGTTTTATGCCTTTTTTTATATA TTTTTAGGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTCAA GTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAACT ACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTAAGTTATGA TTACCTTCAAGTTTGTAAAGCACACCTTAGCTAATGTATTGTATTTGCAT TGTCCCTTTGTTATGAGGATGGACAATAACCTTGTGGCAAAAGTGCTTGT TGTAGCTCATAACTGCTAGTTCGAAACACTACCACTCCAAATGCTTGATA TGATTTGTTTTCTCATGAACACACAAAAGTCTGAGATGAGGAAACTGTAT GACCTGTATTCTGTGTAGTGTGTAAAGTACTGTAATTCATTTTATCTTCA GGGTAGCAAAATTTCACTGTATAAGTAAAGTGGACATTTTCAGTGATCTT TAACTTCACAGTGGCGGCAAGTGATTTACAGAACGGATGCGTGAAGGAAT CATAAATAGTAAAAACAGGTTATTTCATGGTGATGTCACTAATAAGTTTA TGGTACAGACTGAGGTGACAATGAAAACAGTGAACATAAAGTTACAGTGA AAGAAACAAGAATCACACTACTTTGTAAAATGTCAGTTAGATAAGTCAAA AGAAATTGTGTTGAATAATTTCCTATGTTTAACAGGTCCTCCCAATGTGA ACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACAGACCTG CCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGGGGATGA CCTCACAACTTGTGAAGGTAACCCCAAACTGTTGTTTGATCATTAGATTC TGCTCATTTGTGGTGATGTTTTGCTGAATCTTGCAGTTCTTTTGACAGCA ATGGTTGCTGACTGCTAACATACTGTTACTGTAATTCTGCCAGATCACAT GCATATATCTGTCACTCCCCCCCAAAAAAATGTGTCATCGAGATCTCCAA TGCGACATCATCCAGTATAATGCACTCCTTCTATCTATAATTTGTAGTTG ACTGTACGAAAGTCGCTGTACTTTTTGTTATGTCAATAAAGCATATATCT AATCTAAACTGTGCATACCGTTGACACTCCCAATACTGTTTTTATAAAAA GCAGATATACGTATGTAAACCAGTGGATAAAAGTTAATTATAAAGGAGGT TACTGTTGAAAAAAAAATCATGCAATGATTGACACTACATGTACATGTAT GTCAATTTGCTTACAAAATCAAGCTTAACATTTCAAACTTGAAGTTCTTT ATACATGTAGATGCCACAGATTTTTGAAATTTCACTTAAACATGTACTCC TTTTCTCTCAGATATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGA TCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTC ACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTCA GTTTCAGGGCAATGTTACTGCCACAGTGCATATCTTTGTGGCAGTGACTG TGCATCCCTATAGTCAAAGAGCTTTGAAAACAACCCCTGTAAATAGTTTC ATCAGGTTGGTAGATTGAACATCGTTTTCTAATGTACACAACGGTTATTT TTTGTCTGCTGTCTTCCACAGTGTTAAATGAAATTGTCCTGAGGATCAAT GCAAAGTAGACTTGTCCTATTGTGACCTAATTATTTCGATAAGAAAATCT CAGGAAATAAGTTAATATCAAATTGCTTGAAATTCCATAAAAGGTTATGG AAAGACCTTAATGTTATAAAATGTTAATGTTTGGCATTTCTGTGCATTTT GTTTTATTGCAGCTGTAATTATCATTTAGTGTTATCTGCAATTGACTTAC CGCAAAAAATTGTATCCAGCACTATTTGACTAAATGGAGACTTAAATTAA CTACACTATGTTATTTTTTATTTTGTTACTGTCCTTTCCCTGTCACCTTT TTCACTCCTCACATAATTTCTCTGCTGTCTTCTTCAATAAATGATTTTGC AGGGTTTTAAACAAGCCCACAAAATAATAATTTTTTCCGTAAATTTCTAC CTACAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCAAA AGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGTGG CAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGGAA CTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCATA CAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAGTT GGATGTAAGAAAAAAATGTTAACTTTGTCTCATCATGGAAAAAAGATTTT TTTAAATTACTTTGTTGCAGCACAAAAGAGGACAAATTTTGTACAGTAAC AAGTTGTGAATCCTTATTTCGTACCAATATGTACCAAACGCATTGAATTT CAATAGTCTTTTTTCACAAGAACACTCTGGTGCAAAGAACAAAACTTTGA CAAGATGAACGAACTATACAACCAATCAGTCTCATCATTACAATGCCACA GTGGTAAAGAGCAAATTAAGCAAAATTGAAATGTTCCGTCTGCCTTTTTC ATTGGCTGACTGTTCCTGTACATTATTTAGTCTGTCAGCAGCAATAAAAC CTCTGTCAGTACGAAGTGTGCTCAAATAGCAGCAAAATGTTGAAATGTAA ATTGTAGATGGTTACATGACAGAGGTAGTGCAGCAATATATACATGTACA ATGTAATTCCATTGCCAGAACTCTTGGCAGATGTGAGCCATTGATAAGCC ACTTATTTGATATACGTCTGTAGAGATTTCCAGCCTATTTTACAATGTAG TCCTTGACTTTGTCAAAGCCTCAATGGCCATTGTTCACTGTGTCTGTATC TATATAGCCGGTATAACCGCCATTCGGTGTAGCACACCAGCTTCGCAGGC ACGCGGCGCGGCATCAGCTGGTTATATTACACCAAACGACCTGTCACGTC TAACCTTCGCATATGTAACTGCATGTATTGTTTAAAGCTATCTAATGAGG ATGCTTCCACTGTACTTGGTTGTAACGAGTTCCACTCTACGATCGTTCTA GGAAAATACGAATTTTTAAACACATCAATCCTCGGTTGGAAAGTCTGATA CTTAAAGGCATGGCTATTTCTTGTCACTGTAGTACTAGTTTGCTATAGAG TAAAGACACACCCCATGCCAAACTACAGCCTGCACTATACTGTATACATG TGGCAAACTCTGCAAGAGTAGAGCTGGATTAGCCGCCCATGGTCGAGTAC ATCGACGTTTAACAGATTGTCCGACAGGATGAAAACAAGAAGAAGAACGA ACAGAAAGTTGAAAGTACTTTTTATATCTTTTAGATCCATGGTTTGGAGG AGCCCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACA GACGCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCG TAAAACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGG ACCCTAAGAATGGGTACGACTGGGTATTCTTCCATTATTGGGGTGCAGGG CTCGAAATACTGGGTGCATGTGCACCTCTGTGCACCCAGAATTGGACCTG TGCAACTAATTTTTAACTGTTGGTGCACCTGTGCACCTAGATATTTTTGT AGGCTATCAGCGTAGAGGTACTATTGTACACTGGTATACAAAACATTCTT GAAATCCAAGTATCTAAAAAAGTAATATAACCTTTGTTGTACTTTGTTTT ATGCATAATGTTTGAAATTTTGAACTTAGATACTTAATATGTTTTACTGA CATTTAGCTTTATTTTATGTGGTGCACCCAAAATTCTTTCTGTGCACCTA ATTTTTTTGGTTGGGTGCACCAGTGAACCTATTACCAAAAAAGAATTTCG AGCCCTGGGTTGAAAACGTGTAATATTGGATTCTCTGGTTGTATACTAAA ATAGAGTTTTGTCTTTTGAAATGTTGCAGCTCTGGCCTCGAAACTCATTA TTCACTGATGCAAATATCTGATAAACAATAGATAGAAAAAATATGGCTGA TGTAATGCACATTCACATGTACAAAGGAAGAAAAGGTTTAACTTATAGAA ATGATAAAAGAAATTCAGGTTGTCTATTACAGTGACTGTAAATGTAGAAA TGTTTGCGGTGGTTTTAATTATGTTCACAGTTTTCGCAGCGACGGTACCA CCGCGAACTTAAAACCACTGCAAATATTTTTGTCAAACACTTAGGAGTAT GTTGCTATAGCGCTGCCACGGACTTAAAACCACCACAAACTCTTCATTTT CACCTTAGCGCAAACTTAAATGCATTTACAGTGACTGCTCATATATAGTG CCTTGTGGTCAAATAGCAAACATTGATGTTTGGATTTCTTCATATACATG TGTTTGCATTTCTTTGAATACAGATATTTTCCTTTAAATTTGTATTTGTA AGACTTAGTATTAAACAATCGTCATTGATAGTCCCCACCACCTTGAGCAT AAAAGAAACTGAACATCGTGTGGCACAATCGGTAGGATGTTTCGCCCAGA ACCGAGAGGTCCCGGGTTCAAAACCAATGCTATGCCCCGATGCTGTGCCC TTGGGAAAGGCACTTTACACGACTTTCCTCACTCCACCCAGGTGTGAATG GGTACCTGACTTCGGTTGGGGAAGGTCGTATTGAGGTCACCTGCTGGCGC CGAATGGCAGCCGCCCAGACCCTTCAGACAGTTCCACAAAGTGCAAGTGT GGAGCAAATATGTATCTGTTGTGTATTATGTGATTGTAAACCCTGCAGCA ATTCAGCACTGGCTGCCATTGCACGGGTAATATCTGACCAATAAACCTGA CCAATATATCAACAAATAACACTGTTACTATTTACTTCCTAAGGTATGTG TTCTGGACGGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGA CGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAG GGCTGGCCATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAG AAGAACACCATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGC AGCCAACTACAGTAAAGGTACGGTGGCAAAATATCAGCAGAAGTTCTGTA GACTTTGCTTCTAAATTTTTTTTAACCTTTAGCACACTGAAGTAGCCTGA AGTAGGCACCTAATTTCCTATCCGTTACAGAGTTAGGCAGCAGGGATAAG GTTAAAATGAATGGTTTTATGCATTTCCCCAGTTACTTTTCGCATTTACA TGAAGATCCACCAATTACATGAGATCTTGTATGGATGGATGGAAGAAAGG AAAATAGATTAGGATTTGATGTCCTCTTTTTGTGACACTTGTATGAAGTA AAAATACATTATATACACAAAGGCACATCCTAAATACAACGAAGGCCAAT TATGGTCCTTATGCAGAGTTATTAAGTCCCAAGTACATGACTGGAATAAC AAGCAATTATAGTTTAAAATGTGTTTTTTTCCATTACACCAGGACTGTAT TAATCAAATATCATAATAATATTTCATTGACCTGTTTGAAGACAACATCT AGTATGCATATGTGGGCAATAGTCTTCATTTAAGGGAGTTTCGTTTACCA GCACTTTAGTACAATGAAGTTAAAAAATGTTATTAATTTTCTCCACACAA GGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAACATCTATAT GTATGTTGGCAAAAGCCTACATCAAAGCATATTTCATTCACCCGCATGTA GTGAAATTAAGTTTAAAATGTTTCTTCCCTCAATTTCTTCCCTCAAGGAC TGCGTCAGCCGTACCTCATCGACCTGTTTGAAGACAACATCTACGGGACG ACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAA CGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTGATGTCGTCATCT TCCAACAGCACAAACAGGATCAGACAAGTGAGGCTTTCATTATTATCTTC GCCGAGAAGATTATGTTTTTGGTTACTCAAGCTGTTGGATGGGTCTGTAT GTATGTCAAGAGCATAACTTGAGAAACCTTTAATGGATCTTCATGATTTT CGTTAGGTGTGTAGCGGTTGTGCAAAGGAAGGTCAAGTTCGAAAATGGTT TACCTGGCGTTTTCCAACAGTACTGCAGCGGAATTTGCATTTTTGTGTGT TTGTATGTAGTGAAAAAAAGTGACGGATTTAATGTTGATGAATCTTCATG ATTGTTGAATCTTCATGGTTGTGGGAATGGAGTCAAGTTCAAAAATGGTC AAAAAAGGTGTGGTCAAAGAACCCACCACACCTTTCAAAAAAGAGTAGGG GCATGCCCCTATGTGCGAATGGTCCAAACCTCTGTTTGGTCTGGGCATGG GTTGACATCTTGAAAAGGTGATAGTCACCTGTTATGTCAATCCCTCTACA AATGTGGTAAATCTAAATGAAAAATAATCGAATCCCTGACATACACAATG TATCTCTTACGTGGTAAAACAATCTCACATCTCACCTTCTTCCCTCACAG TTACGAACCCCTGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCG CCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCT CGATGGAAACTCTTGTCTGAATGTACCAACACCTTCTCCTACAGGTAAGA ATGAAAGCCTGTTCTTTATACTAGACATGTGCACTGGCCAAGTAGTGAGT AGTGTTCGCCTTGAATTCAGTACGTTGTGAGTTTGATCCCAAAGACTTTA AAATGTGTACATATTTGTTTTCTCTGCTTATTATAGCACTCAGCATTTGT TTGTCATGTGTTTAGACATACAAAATTAACCAAAGTCTGACAATAGCATA TCCGCTTAGGCTTAGCACTGATCAGAAGTACATGTAAAGTTGAAGAATGA AAAACATAAAAAGAAATTGTTTTAAATACAAATCAAAGTACTGATTTGCT GAAGAGGCTAGTTTTTAAGACCGTTTCAACAAAATCCTCTGTCTTGTTAA CCTTGTGTTGTTGAGAACTCTTGACAACAGTATTTTGTTGAAAACCTTTA CACTGGATACTAAAAGAAGACATTTTTGTGACATACAGATATCTTCTCTA ATCAGTAATCACTAATACTACCATTCAGTAGTGACTTCAGTCTACCTCAG TGTGTTGATAACATACTGTTATAACTTGTTTTCTAGGACCAACAACGACA GCTTGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCAC CAATGAAAAAGGGGACCCCAAGTGCAAGTAAGTCTGCTATGCTCTGCTTT AGGATTCATCGCACTTATACCAGAGAGAGAGTGTATTTGTAATACATGTG TATATGGAATATTCCAATTCTTTGGTATAACCATGGACATGTGCTGTACG ATGATCCCCTTAGTTTCGCGAGCCTACAAAAACACAATTTTTGGTGAGTT CTCACATCACAACAACATCATATTTTTGCATCATGGACATTGCTATACAT TGCGATAGTGTTGTTTGAACTAATCATGACTATTTTGTATAGAAATTACT AAATAAATTGACTTTTGAAATCCAATTTTCGAGCACTAATATGGCTTGAG TTTCCTTTAGTGAAGTGAAAACAGTTTTAAGATTGTTCAATAAAAGATGA AGTCAGGATAAGGTTGAATAAAATGTATGCTAAATGTGTTCTTGTATCTT CTCTAGGTGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGT GTTACCGCTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAA AAACCAGTCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTC CTCATGCGATAACTACTGCCAAAATGGAGGCAAGACAACTTAAATAACTT TTTTTCACTGGCTCTGTTCCAAGCTTAAACCACTTGTTGATAGCCTAACT GCTGAAAATATCTGTGATTCTTATATTTAGTTAAAATTATGATTTAAAAC AACACAGTAAGTCTAAGAAGGGGTTTTTCACCACTGCCAAAACGGAGGCA AGACAACTTTTTCTCACTTGCTCTGTTCCAATTTAAAACTACTTACTTGT TGAAAGTCTAAATGCTGAAAATATCTGTGATTTCTTATAATTATGATTTA AAACGACACAGTACTAAGTCTAAGAAGGGGTTTTTCTAGCAAAAAATTGC AAGGGGGAGTATTGGAAAGAAGTAGAGTTGCCAAGCGGGGGAAGATGTGG AGGGGGGGAGGGTCCCCTTACTTGCTGTGGAGTTTTACAGAATCTTAAGT TAAAACTGGGCATTCTAAGGCTTCCTGAGGGTCAAAATTACTGTCAGAGA GGTCACAGTTAAAGACTGTGGCCATATTTGATCTACTTGTAGTAGCATCC CTGGCCAATCAGATTCTTATTCTTGTCAGAGGATTTGCTCCCCAGGGTAA GGGGGCGCATTGTCAGGGCAGCGTTGCCCTTGTTCCCCTTTTCAGATAAT CCCCTGACTAAGAATACTCCATAGGCTGATTTTGATTCGACCTTTGCTTG TTTCAATATTTATTTATTTATTTATTTATTGGTTCAGCATGTATATGCCA GGGTTGCTCAACTAGCCAGAGGCTATTACTAAGGGCGAACCCATGTGCGG CCATAGGACTGTAGGTTTTGAACCACTAACACCGGGAAGGACCCCTACTC TTTTCGATAAGTGTGGTGGGTTCTTTAACATGCTTGAGGTGTGGCTCTCC TCAAACATCGGACCTCCGTTTAATTTCCTATCCAAGGGACGTCAGTAACC GAAGCTAGGTAGTACTAATTTACACCTGAGTGAAGTGAGGAAAGTCGTGT AAAGTGCCTTCCCCAAGGGCACAACATTGGGGCATTTCGGTAGTTTCGAA CCCGGGACCTCTCGGTTGTGACCCTACTGATTGTGCCACACGATGTTTCA ATATTTTTCTTACATTCCCCATTGCAGGCACCTGTAGTGTGAGGGGCAAT AGAGGAGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAAC AAATCTCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCT CTGGCAGTATAACTTGTGTGTAAGTACATCGTATCTTTTACCTTGTAGAT ACGTAGCTACATTTTTTTCTAGACCATGTACATGTGTATGAGGTTTAAAA TCTCCAGGTGAAAGAGAAATCACACTGATCTTTGGACTTTGTGTGTTTTA AATGAAATTTCAGCTTATTTGTACTCAAAATGTCAGGATTAGAAGTCAAG GTGGAAACATTCATGTATTGGAAAAGCAACTGAACTAAAATCAAGCAACA ATGCCATGATGCTTTAATTGTTATGGCTGTATTGGATCTTATCAATATCT TATCAACAGAATTTAATGCAGGGTTATTAGAGAATGATTACAAAATAAGC TTTAGAATATTTTCAAACTAAGTTAAGATGATTTCCTTGTCACTCAGTGT CTAGTCGCTGCTTTTGAGGCTTCGGAAAAATATCACAGCAATACATTTGC AAAGAAAATTCAGTCACAAAAAAACAAAGAAACAAGATAAACGATCATCA AAAAAACTTGTCAGAAGCCATGCCATGATCTTAAATCATTTTCCATTCCT TGTGTTTACAGTACATATACATGTAGTTCAAGGTGAAATTTGGTGTACTT CCGATCGGCAATTCGAAATGAAAAGAGTACACCTAGCCACAAAAAAACAG TTACGTAAGCAATTGGATAGATTTTAGAGGTACATCCACTACCTTTCGTC AGTTACTGAATGAGAAATGTAGACTACCAGCTTTTAAACCGAAAAGTATA AATTTTACACCTGTCCTAGTCTTTCACACAAATGTATTTGAAAATTAGAT TTTGGAAACAGTCAAACGTTTCAGGTAGTATCCACTACCTTTCGTCAGTC ATTGAACGAGAAATGTAGACTACCATGTTTTAAACCAAAAAAGTATGAAT TGTACTCCTAGTCTTTCACACAAATGTATTTGAAAATTGGATTTTGGAAA CAGTCAAACATTTCAGGTACATCCACTACCTTTCGTCAGTTACTGAACAA GAATTGTTGACTACCAGGTTTTAATTTATAAAACCAAAAAGTATGAATTG TACTCCTAGTCTTTCACACGAATGTATTTGAAAATTGGATTTTGGAAACA GTCAAACGTTTCAGGTAGTATCCACTACCATACGTCAGTCACTAAACGAG AATTTTAGACTACCAGGTTTTTTAAAAAACAAAAAGTATGAATTGTACAC CTAGTCTTTCACACAAATGTCCTGTTTCCCCATATAGGTCGCCTACCTCT GCATGCGAATCTTGGTTCTGTAGTAACGGTGGTGCATGTGAAATAAATAA GCTTACTAACATCCCATATTGCAAGTAAGTACAGTCGGTTGGTGGTTTGT GACATTAATACATGTAGGTAGTAGATGGGAGCAACTCAAATTCCAGATTG AAGTGTATGCTTTGCTTGATTGTAGTCTGTTTGGTGTGGCGAAAGTGTGG TATACATGACTTGTATGCAGGGATCTCCCCGGATATATAGAGCAGGATGG AGGTAGATTTTTATTTTAGCTATTGAAACATCTCGAGATTTTTATATGAG CTATTTAAAAATCTCGAGATTTTTGTATTAGGTACAAAAAATCTCGAAAT TTTTGTGGAAAATTTTGAGATTTTTTAAAAAAAGTTTTGAGATTTTTTCG AAAAAGTTTTGAGATTTTTTTGAAAAATTTCAAAATGAAAAAAAGTTTCG AAATACCCTAATTTTGAAAATCAACAGGATGGAGCTGGGATTAGAACAGA ATATAGCAGCAAGGTTCTATATATTCTAATTACGGAGATCTCTGTGTATA TATCTGCATGTACAATGTAACTGTCTGAGTGAATTTTGCATGGTTCCACT AGTACATCCCCATCTAATTTCTTTCACTGAACACCTACTAGTAATATCAC AACATGGTTTTGAGATGTTCTTAATATTGGGTGGGATTTGGACAACCAGT TGGTAGAAAGTAGGTCAAAAATGTGTTTCATGTGAGATAGCAGTATTGTT GAATGCTACCACTAAGAATGAAATTGACGCAAAAATTGTGTCTTCTAAAA CTACCCTGTATGGCTATGCTACAAAATTTAGAACACATTGTTTAAAAAAA AGGTAAAGGTAGTCCTATAGCCTTCTTAAGGCCACATGCGCAGTGGGTTC TTATCCACTGTGTCTAGGGCATGGTATCGGAAGGCAGAGCCCAACCCTCC CCTTCCACCACCTTTTACCTCCCCATCCGAAGACAGGTACCCATTTTTAC ACCTGGTAGTAGTAAGGAATTTCGTGGCAAGTGCCTTTCCCTAGGGCACA AGATTGGTGACAGGACAGGATTCGAACCCAGGGGTTGTGGGACAAACACC CTGGCGTCTCGCTACATGGCCCTACAACACATTCTTGACCAACGAACAAA ACGGCATTGTCCGAATCCCACCCAGTATTAAGAACACATTGAAGTCATGC AATCGTTTCTTCGTGAGAGAAGTTAGATGGTGGTGGACGTGTAGTAATTG TTGTATGCTGTGCATCATGTGTGACTAAATCCCTAACTCTGTCCATCATC TTGTTTTTCATTTTAACCACTAATCTTATGATTTGCAGTGTGATTAGACT AAAGAGCTTTTGTGTTGTGAAGTTTTTAAGTACCTTATGTGTCTAGGAAA TAGAAAAGACCCCAAAAGAAACTAACATGGCAAAGGTAAACTAGTTGCGT GTGCTTTTTGCACTCCAAAAAAAGCATATAATGCACAAAAAATCTGAAAC CTCTTACTTTCAGCTTCTAAACCGTTCAAACCAAAACTAAACGGTTGTTT CTATGAACTATTTTCTCTTGCAGTTGTCCTGAGAACTTCCACGGACCACA ATGTGAGTCAACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAA AATGCAGTTTAGATGATAATAACCAACCTGTGTGCGCGTAAGTATATTTT GTGCCATATATAGCTACATGTATACATTGTACAATGAATTTGTGTGTATT ATGACATTGCATACAAATTGAAGTTAAAGACACTGAAGTTCCTATTATTA GTAAATACTTGTTAGGCATTGCTACTCTATGATGTTACTCTATGATGTAT ATTGCTGTTGTTGTTGTTGTTCTAGTCAATTCATTTATAAACAATATTCA ATTTAGATGACCTCACAAAAATTCCTGTGGTTTTGTAGGCACTGTCTATG AAGATACCTGATAGTAATTATAAGATGATTCAACACATGTAAATGTTTTT TTTTCTCTTTTTCTATATTTTGATACTGCAGGAAATTCCATATTTTGTGA CTTTTTGTAATACATTGTATATGAAAGTTGTTGTTGNTCTCGCTACATGG CCCTACAACACATTCTTGACCAACGAACAAAACGGCATTGTCCGAATCCC ACCCAGTATTAAGAACACATTGAAGTCATGCAATCGTTTCTTCGTGAGAG AAGTTAGATGGTGGTGGACGTGTAGTAATTGTTGTATGCTGTGCATCATG TGTGACTAAATCCCTAACTCTGTCCATCATCTTGTTTTTCATTTTAACCA CTAATCTTATGATTTGCAGTGTGATTAGACTAAAGAGCTTTTGTGTTGTG AAGTTTTTAAGTACCTTATGTGTCTAGGAAATAGAAAAGACCCCAAAAGA AACTAACATGGCAAAGGTAAACTAGTTGCGTGTGCTTTTTGCACTCCAAA AAAAGCATATAATGCACAAAAAATCTGAAACCTCTTACTTTCAGCTTCTA AACCGTTCAAACCAAAACTAAACGGTTGTTTCTATGAACTATTTTCTCTT GCAGTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTCAACAACAAAC TTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTTTAGATGATAA TAACCAACCTGTGTGCGCGTAAGTATATTTTGTGCCATATATAGCTACAT GTATACATTGTACAATGAATTTGTGTGTATTATGACATTGCATACAAATT GAAGTTAAAGACACTGAAGTTCCTATTATTAGTAAATACTTGTTAGGCAT TGCTACTCTATGATGTTACTCTATGATGTATATTGCTGTTGTTGTTGTTG TTCTAGTCAATTCATTTATAAACAATATTCAATTTAGATGACCTCACAAA AATTCCTGTGGTTTTGTAGGCACTGTCTATGAAGATACCTGATAGTAATT ATAAGATGATTCAACACATGTAAATGTTTTTTTTTCTCTTTTTCTATATT TTGATACTGCAGGAAATTCCATATTTTGTGACTTTTTGTAATACATTGTA TATGAAAGTTGTTGTTGCTTGACATTTTGTAATCATTGACTCAGTAATGT ATAATGTGAAATCTTGAGAAGGATCGTTGTAGATTTTTTGTTAATTTTAC ACATTTGTCCTTCTGTTCCAGCTGTTTGAAAGGGTTTGAGGGCCAACAGT GTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGAAGGAGGG GATGGTGGAAGTAAGTTTCTTTGATTTAAGTATTATCTTATAGCATTTTT AGCTACAGCTAAAGTATCATTGGCTCAATGGCCTAGTGGGTAGAGTGCTC GCCTTGCAAACTGTAGGTTGTGAGTTTGATCCCCGGCCGAGTCATACCAA AGACTTAAAGAATGGTACATACTGCTTTCTCTGCTTTACACTCAGCATTT GGGAAAGAGTATCAATATCATGGTAGTTAAACACACACCACTTCCAATGG ACTATCCCCCTGTTGTAGTGATTGCACAAAGTTGTGTAGGCCAACGGCTA TTGAAACGTAGATGGGTGCCGCCCTATGCACCATCTGGTGCAGGAAGGAC TTAACAGTATCATAGAACACTCAGTAGAAAATATTGTACAATTGAGACGG AAAGACCATTCTCCACAAATTTTTTTTCACGCAAAACCGATGTCTTCACT TGATGCCATTTTTGTGGACCATCTGCCACCTTTGCCAGTATATCTTGAAT AAAAAGACTCATTGTACACAACCAAGGAATTTATTAATCCAACGTTTCAG TGACCATCTGTCACCTTCCTCAGGGCAATTCTGACTGGTTCACATTGCAC TGCAGCACAGGTGTTGCTGCTTATGTAGATGCATTCCCAAAAACAAAAGC AGCAACACCTGTGCTGCAGTGTAATGTGAACCAGTCAGAATTGCCCTGAG GAAAGTGACAGATGGTCATCGAAACGTTGGTGGAACAAGACTTAATCTTA CTTATGTACAAAGACACTTTTCATTCAGTGACTTGACAACCTGATGAAAC TATTCACAGATTTCAGTATATCTTGTTCGCTGCCTTTTGCTTTTATTTAC TTATAAACATTGTATGGTTGTTGTATTTCAGCTACTGCTGCTATTGTTGT GCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCT TCTACCGAAAGAGAAGTTCAAGGTATGGACTTTAACTTGTTGTTGAGTTA GATTGAACAGAAAGAGTTTAGTAACAAACCTTAGAAAATAAGGGCAATTA TAGATGATTAAATGTGGTTAGTAGGAGTACTTATTGTTTAAAAGTTTCTA TAATTTCTCTGCATTAACTTACTGTCATAATAATGAAATTATATAATCTC AATTCCTTGAATAAGAAAATGTTATATATTGCACTCTTCTTGTATTCCCT GTGTACTGATGTTGTAGGATATGTGACTCTGTAAACTTAAGGCATGTGAG AGTAGCTACTAGCAGATAGCAGTGTCACACAAGGAACTTTACATGCATTA AAAAACAGGGCTCGAAATACCACCTACATATGTAGCTTTAGGCAAGTGAA ATTGGAGATTTGCAGATATTTCTATCTGCACCTAACCTGCACTAGTCTAT CATAAAACCTGCCTGTTAAACTAGTGTCACATACATTTGTATGATCGGTA CAGTACATGTATAATGCCCCAAAATGCCTTCCATTCTTCATGATACAACA AATAAGTGAACAAGATCCAAATTGGTACTACATGTACTAGTGCTAGAACA TTTTCAAACATTGTTTTTCAACAGACTGAAAGTGAAATCAAATCAATAGT CCATGGCGCATTTAAAACTCGTCTGGTGCAGGCAATTTCGCAATATGTTG CGTTGTATGCAAGACAATTCAGTGTATTTTGAGCCCTGAGAAACCATCTC ACTCACTCACTCATGTGGAAACCACTCTGTCCAACCGAGCTTGTCTTTTC GTGCTTTAGATCAGGGTGGTTCCCAGTATCAGTGGAAGCTCTTGAGCTGA AGTCAGTAGCCAGGTTTCTTTTCCTTTCATCCAACCCTTTCCTGTTTTCA CTCCCCTTTTATTTTTTGTCCTTTCCTTGCTTCTTTTGTAGTCTGTTTTC CAGAAGAGTAGCTGTAGGATAATGAATGTACAATGTAGTTGTTGGTTTTG AAAAGGGCCGTATGTACTCCAATTTCTACACATGGCATCGACATCGATAT ATCCAGAAAATTTAATGAGAAACCTTGATGGCTCATTTCATGCTTGAGAT GCAAATTGTCCAATGACTATATTATGAACTGGTGATTGACATGTGTAGTA ATTGGAGTACATGCAATTACGGTTAACTTTAAGTTATACCAAGATTGCCA TTATTAATTAGTAAATACATGTAACTGGTTAGTGATTTTGCACCTGTTGT ATTGCATGTAGTTAGTTGTTTAGTATGATTATAGAAAGTATCATCATTTC AGTCAGTAACACATACACCTGGCTTTTCGATTAAGGATAGACATCCAGGT AATTAGATATGCAAGGTAGAAGCTACTCAAGCAACTGGATAGAATTTGGA CTTTTTCCATCAAATTTCCACATTTCGTCCATTTGCTTGTCAAGTGTAAC TGATACCTTGCAAAGTCTTGGGTTCTTATAGATACATGTATGTACAGACA ATTAAAGTTGGTGTTTGTATCCTGTGCTTTACAGAACCATGTTCCAACAC AAGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGA CCAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGG ATCCTGACAAGGTATGTATCGTAACATTCTACAATTTAACCTTTAGCACA CTGAAGTAGCCATTTAGCACCCCATTTTCTATTTGTTACAGAGTTAGGCA GCAGGGAGAAGGTTAAAATATGATGCAAACTTGAAATATTAACTTGAAAT AGAGTCTGAGGGCTGTACCTTGGAACACATATGTTAGGAGAGTAAAATAA TACAGATGTAGGTAGATCCAAGTTTTTCTCATAGTCTTCAGTTTTCTTCT GGGCAGCTTGCTAAATTCTTATACTTTGAGATGTCCAAGAACAAATGTAA GAAATTGGTCTAGCTTGAGTGTAACTTTAAGGAGTTGTCAAGCTGATACT TAACATGCTTCATACATTAACATAACTGATGACACCAAGTTATCATATGA TTATTCAATCTGACATCTTGCTCTTTTTCTAATGCAGCTTTCAACCATTC AGTCCTTCTACATTTTGTTACTATAGCTCAAAGTGTAGCTTACAATCTAC CATGACCTTGCTCATTTTCAAAAACATTTTTTACAAATCAGCTGTCCGTT ACAACTTGTACATTGCAACTTTAGCTTGACATATACTAAATGATGTGGTT GACAATCTATAGCGTCTTGCTACTCTCCTTAAATATTCAAAGCCAATCGT TATAGTCCTTTTAATTACTGTAGCTGTTCTTTCATAGCTCAGACAACCTA CCATCTTACTATTTTTCTAAAACATTTGAAGCTATACACATTGCAATGTA GCTCGACATGTACTTACATTTTGTATGTAGTCGACAATCTAATAGCATTC TTACTCTTTTCCTTAAGCCATTAAGCAGTCCTATTACATTACTGCAGCTT GTATGCATGTACATGTAGTTACCTAATGCCTGCTCTTACTCAGACCATTT CTCCTGTCCCCTGCGCTATCTCTGGACTACATCAGGTTGAGGACGATAAA TACCGCTTGGAGTTCTTGGTACCCGGCTTCTTTAACTTCTCACTGTTCCA TATTCAACACCTTGCAATACTACTGTACTGTAGTCTAGAGCACATTATAA AAATCCACAATCCGTATTAATTTATCTCGTGCTTGGAGTCCTTCATAGTT ACTTGTCATCTTTCATTTCAATACCTTCATGTTTTTGCACATTTCAATAC TTGTCTTTAGCAGATGTATAATGGAAATCTTCGATGAAATATAATACTGA TTTTTCTCACAATCGAATCACTTTACATGTTGCACTAATTTCAATAATAA CTACTCATGGTTACACTCAAGTTGAGCCTTATCATTTCACCACAATGTCT GTATTATTTTTGATAATCCCATCTTGAGGATTATTGATCTTTGTTCAAAT GTTTAAAACCCTCCTGTAGAGTCAGTTCAGTTCAGTTTGTTCATCCTAGT TTCAACTCAAGTGACACCATCAATGCCCTTAACAAAAGTCTGTGACTGCA CATTAAGTGAGTGTGAAAGGTCTTAACTGACATTCCATATTTTCTCTCTT TCTAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACAACGAA GCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAAGGACT TCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCCCTTCG GCGGGTCGTCAGTAGCATAGCACACGAGCACCTTCCATTTTAAAACATGT ACATGTTAGATGCTGAAATCTCAATTGTTTGATATGGGAACTTGTACAGT TTGTGAATTGGAGTGACCACTCTTCAGATGTCCATCTAGAATTAATTTTA GAATTTGAATTTTGTTGTTAATTGCTTTGAGGATGCTTGGTATTCAGTGT GAAATCTAGGAAAAATTGTAAGACTGATTCTTGAATCACAGATTCTTAAA TCCACTACTTGATTTAAGAACAAACTTAAGATGTTAAAGTAGCATTGAAG CTCGTCTGTGTAGGTGTCTGACATTTAAACTGTTTTCCAATGCAGAAAGA TTAAAGACTCACAGAAATTTACTGATGTCACTTTGGTCTTTTTCGGGACA AAAAAAATGTTTTGGACATGTGATTCCAATAATTCGTCAAAGTTGCCTAA TACCACTAGTCAACACAACTTGTCAACTTCGTGCAACTGTGACAGAAAAC AGTACAGGCTAACCTTTGACCTTTTATTGAAGTCACATGATCATGTGGGT CCTGAGGAAGGCTACAGTAATAGTTAAAAATTTGCTGAGTCTGAAATTTT GCATGTGTGTCGGAAAAACGTTTTAGAGTGTTACTAGAATGGTAAAAATC TGTTTACGTTCCCAGACGAAAATGAAATCTGTCAAATCATGTGTCGAAAC ATCTTACGTTTCCGTGTGTAACATAGGAGTGGAACAATTTGTCTTTGCTT TATGTGTACGTAGTCAGCCTAGTAGTTGTGTATACATGTAGGATTTGTAT TTTTCCCCAAAAGTGTAAACAAACGCCCACTATTTTTGTGTGCAATAAAG TTCTATGGTGAGTGTAAAATATAGAAAATGCTGCTCAAGTGTAAAAAAAT ATGTCCATTATTTTCCATCATTGGCTTCTTCTCTATTAAGAAAAATAGAG TAAAGATGCAAATTTTCAGTATACAAAAAATGTACATGTAGTGGTATGCC ACTGTTTTTGCCACACCCTTCATAGGGATCGAATGGACAGAATCGTGGAG TTATAGATATATATCTTTGTATCCCTACAATCTTCCAAGTATGATATTTC ACTGGGTTGTAGACGTTATACTTGTGAACAATATGCAACTGGTTTGAAAG TAAGCGATCTTGCAAAGCAGAAATCTCGCTATGTAAATGACGTTGTGTAA TGGAACAACGTGATCCCATTCATTTTCAAAAATAGGGCTTTTCTTCCATT TTGCTGATTCCTGGCAAAATGCCGCTATATCAAGTATAGGTTATGAACCA AGCTGCCTAGTTTTATCCAAAACTGCTTCAAATGCACATTTAATGCAACT TATCAGTCGTTAATAACTATGTGTCGAATTTCATAGTTCCAACAGATATA TTGAAAGATTATTACTTATAATTACTTTCTTCATGTAAACAAAAATATGA GTGACGTCTGAATTGATTTGAAATCTTTAATTCATAATCTCTGACTTGAG CATACAAAGCCACTGACAAGCATTGTTAATCGTTAGACAATGAAGAACAT TTTTCTTGTATAGTATTGGGTAATACTTTGTATTGTGATCTACTTTATGT GAATATTGATGATGGGAATTTAGAAGTTAGTCATTATAATCACGCAAAAT ACTTCCACACACAATATAGGAGAATCCATGCATTATTTCGTGTGTTTTGA TTTCAATTTCATAGTAAAATATTGATGTCCTACTAAGTCAATTTAAACTG GAGCAGCTTTACATCTAAAATATTCTTTCTTTTTTTGCGGTGCAGGTTGT CATTCAGAAGTACATTTTGTTAGTTGTACTGTGTGCGAGGTTCGTTGAAT GTAAAAAGCCAAGTTAAATCTAATCGGTGGCCTATTTACAATTGCAGACT GACTATTATAATAGCAAGGAAAACACTAAATGTTAATGCCATTAAAGTCG AGTTTAACATATTTGTTCAGTATCATTAGGCAAAAGATGTCACATGTAAA ACTTTGTCAAGATTCTGTCGAAAAACTAATCTACTTATTGCCACAGAAAA ACTTATTGTGTTATGATTCCATTGGCAAATTCCAAAGGCCGCCTGGACTA AAGTGTTGTACTGTTTCAAACTACAATTATGACAAAAGATGCTTCACTTA ACCACTATGTATGCTTTGTAACAGTTGCGAGAAATTTATTTATGCCTCAG TTCACCATAGCAAAAATGATAGTCTTACTGAAAGCGCACATCACTGCTGT AAAAAGAAATTGGCTCATCATATGAAGAAATTAAAGCTTTTGAAATTTTC TTGTCTGGATGTGAACCATGGTATGCACC

Coding sequence (CDS) from alignment at Sc0000014:4099497..4127675+

>transcript:BL96923_cuf21 ID=transcript:BL96923_cuf21|Name=transcript:BL96923_cuf21|organism=Branchiostoma lanceolatum|type=CDS|length=99225bp|location=Sequence derived from alignment at Sc0000014:4099497..4127675+ (Branchiostoma lanceolatum)
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAGGGTGGCTGCCATAACCTCTGTTTAC
TCCAACCCGGCGGGAAGCGAACCTGCGCGTGTGCGGAGAACTTCTACCTG
GCCTCGGACGGAAAGACCTGTCTGTCCAACTGCACGTCCAGCCAGTTTGA
GTGCGGCAACTTCAAGTGCATTCCCTTCTGGTGGAGGTGTGACACGGAAA
ACGACTGCGACGACGGCTCGGATGAACCTGAAAGCTGTCCGCCCTTCGTG
TGTCGTCCTGGCCAGTTCCAGTGTAACAACTCGGAGTGTACCAACCCTGC
CTTCATCTGTGATGGTGACCAGGACTGCACTGATGGCTCCGATGAGAAGA
ACTGTGAGCACCACACCTGTCTGCCGAACCAGTTCAAGTGTAAGGGGGAG
AACAAGTGCATCCCTGGGATCTTCAGATGTAACGGTGCCACCAACTGTCA
GGATGGTAGCGACGAGCAAAAATGTCCTGAGAGAACATGTGCAGCGAACC
AGTTCAAGTGTAACTCCTCCAAGATCTGTATCCCGCGAGTCTGGATGTGT
GACGGAGACAACGACTGTGGCGACGGCTCGGACGAGCCCAACAACTGTAC
AGCACGGAGCTGCTCTGACAACGAACTACGCTGCAACAACACAGGTCGCT
GTATCCCAGCTAGATGGCAGTGTGACGGTGACAATGACTGTGGGGATGGG
TCGGATGAGCAAGTCGGTGTCTGCAGTGCCCGTACTTGTGACCAGTACCA
GCACCGGTGCAACAACAACAAGTGTATCCCGGCCCGCTGGCGATGTGACT
ATGATGATGACTGTGGAGACAACTCTGATGAAGACGGCTGCACACCGCGG
CCATGCTCTGAGAGTGAGTTCCAGTGTGACGACAACCGCTGTATCCCCGG
CCGCTGGAAGTGTGACGGAGACCATGACTGTGAAAACGGTTCAGACGAAA
GCGGCTGCTCGGCTACCTGCCTGCCAAACCAGTTCCAGTGTAGAAACGGA
CACTGTATCCCACAGGGCTGGCACTGTGATCTGGACAGGGACTGTCTAGA
CGGGAGTGATGAAGACAACTGTGAAACATCAGAGTCCCCAGGAGTTCTGT
GTAACGAAGGAGAGTTCCAGTGTAACAACACGCTGTGTAAGCCGCTGTCG
TGGAAGTGTGACGGAGAGGACGACTGTGGGGACAAGTCTGATGAGGAAGC
CTTCATGTGCAAGAACTTTGTGTGCCCGCCCACCCGTCAGTTCCGTTGCC
GTAACGACAGGGTGTGTCTACCCATCTCCAGACGGTGTGATGGTTTCAGC
CACTGTGACGACAACTCCGATGAAATAGACTGCAGAGCACCAGCAGAGAA
CAGAACGTGTACAGCAGACGACTTCAAGTGTCTCTCAGGCAACAGATGTG
TCAAACTGGACCTGGTCTGTAACAACTACGACAACTGTGGGGATGGGTCC
GACGAAGGGCTGTGTGGTCCTCCCAATGTGAACGAGTGTCAGACCAACAA
TGGGAACTGCCAGCACATGTGCACAGACCTGCCCCGTGGACACTACTGTA
CATGTAGGGACGGCTACACTCTGGGGGATGACCTCACAACTTGTGAAGAT
ATTGATGAATGTGCAGATTTTGGCAGATGTTCCCAGATCTGTACCAACAC
CAAAGGTTCCTACCACTGTTCCTGCTCGGCTGGGTTCACCAAGGCACAAC
GCAGCAATGGGGTGGCAACATGCATAGCAGAAGGTGATCCTGATTATCTG
CTTATTGCCGACGACAACGCCATCAAAAGAATCAACCCCGACAACATTCG
CGATGGGTCCGGCGACGGTTACCGTGGCAACGACAACACACGTGTAGAGA
GCATGGACATCGACGTTAAGTCTGGAACTGCGTACTGGAGCAACATCCAC
ACCAGCAGTATCTACAAGGCAACCATACAGCTGGGCAATGGCAGAAAGAA
GAGACAGGCTACTGATATTGCCAAGTTGGATATCCATGGTTTGGAGGAGC
CCCGCGGGATCGCCATAGACTGGGTGGGTCGTCATATCTACTGGACAGAC
GCAAGGAAAGATGCGCTGGAGGTGGCCAATCTGAACGGGACCAATCGTAA
AACTCTCCTCAGCACCGGGATGGACCGACCGCATTCTGTAGCAGTGGACC
CTAAGAATGGGTATGTGTTCTGGACGGACTGGGGCTTGTCTCCCAAAATC
GAGCGGGCGAGACTGGACGGTTTGGAGCGGAGGGTTCTTGTACGCGAGGA
CCTCCAGTGGCCCACAGGGCTGGCCATCGACTACCAAAACAGGCGCCTGT
ATTGGGCAGATGCCAAGAAGAACACCATTGAGAGTATTGACTTTGATGGC
AATGGAAGGGTAGTGGCAGCCAACTACAGTAAAGGACTGCATCAACCGTA
CCTCATTGACCTGTTTGAAGACAACATCTACGGGACGACGTACCTGACTG
GCGAGGTGTTTAAGGTGGACAAGTTTGGACGGGATAACGTCACGGTCCTG
GCCAATAACCTGCAACACGCTTCTGATGTCGTCATCTTCCAACAGCACAA
ACAGGATCAGACAATTACGAACCCCTGCAGTTCCTCCAACTGTACCCACC
TGTGTTTCCGTGCGCCCATGCCTGGTGGTGGCACCATCTGTGCCTGTCCC
AACGGAGGCAACCTCGATGGAAACTCTTGTCTGAATGTACCAACACCTTC
TCCTACAGGACCAACAACGACAGCTTGTGATCAGGCTGGGATTATATGTT
ACAATGCAGGAACCTGTATCACCAATGAAAAAGGGGACCCCAAGTGCAAG
TGCCATCCGAACTTCCACGGTCCCCAGTGCAGACTGAACAAGTGTTACCG
CTACTGTGCGAACAACGGGCGCTGTCAGCTGAACTCGCTGGAAAAACCAG
TCTGTACCTGTGTTGGAGAATTCTTCGGACCTCGCTGCAACTCCTCATGC
GATAACTACTGCCAAAATGGAGGCACCTGTAGTGTGAGGGGCAATAGAGG
AGTTTGTGACTGCCCGCTACCCTACGGAGGTGACCGCTGTGAAACAAATC
TCTGTGACGACCGCTGTAAAAACGGAGCGACCTGCACTGTACTCTCTGGC
AGTATAACTTGTGTTTGTCCTGAGAACTTCCACGGACCACAATGTGAGTC
AACAACAAACTTGTGCTTCGATTTCTGCCAGAATGGAGGAAAATGCAGTT
TAGATGATAATAACCAACCTGTGTGCGCCTGTTTGAAAGGGTTTGAGGGC
CAACAGTGTACAGAAACTGTTCCTTCAACTAAGGGGGAACGGAAGGGAGA
AGGAGGGGATGGTGGAACTACTGCTGCTATTGTTGTGCCAGTTGTACTTG
CCCTCATTATCATCGCTGTGATCTGTGGTGTCTGCTTCTACCGAAAGAGA
AGTTCAAGAACCATGTTCCAACACAAGCGCATGACCAACAATGTGGAGAT
AGGGAACCCAACCTTCCTCTACGACCAGGAAGAAGACGACGAAACAGAGC
AGTTAGACCCGTCATTAACCTTGGATCCTGACAAGCCAACCAACTTCTCC
AATCCTGTGTACGACTGTCTTTACAACGAAGCTAGCGGCAGCTCGAACTC
ACTTACAAGTACGGAAGAGAAGAAAGGACTTCTCTCTCCGTCCGGAATTC
AGTTATACGAAGATCAGAACGACCCCTTCGGCGGGTCGTCAGTAGCATAG
GGTGGCTGCCATAACCTCTGTTTACTCCAACCCGGCGGGAAGCGAACCTG
CGCGTGTGCGGAGAACTTCTACCTGGCCTCGGACGGAAAGACCTGTCTGT
CCAACTGCACGTCCAGCCAGTTTGAGTGCGGCAACTTCAAGTGCATTCCC
TTCTGGTGGAGGTGTGACACGGAAAACGACTGCGACGACGGCTCGGATGA
ACCTGAAAGCTGTCCGCCCTTCGTGTGTCGTCCTGGCCAGTTCCAGTGTA
ACAACTCGGAGTGTACCAACCCTGCCTTCATCTGTGATGGTGACCAGGAC
TGCACTGATGGCTCCGATGAGAAGAACTGTGAGCACCACACCTGTCTGCC
GAACCAGTTCAAGTGTAAGGGGGAGAACAAGTGCATCCCTGGGATCTTCA
GATGTAACGGTGCCACCAACTGTCAGGATGGTAGCGACGAGCAAAAATGT
CCTGAGAGAACATGTGCAGCGAACCAGTTCAAGTGTAACTCCTCCAAGAT
CTGTATCCCGCGAGTCTGGATGTGTGACGGAGACAACGACTGTGGCGACG
GCTCGGACGAGCCCAACAACTGTACAGCACGGAGCTGCTCTGACAACGAA
CTACGCTGCAACAACACAGGTCGCTGTATCCCAGCTAGATGGCAGTGTGA
CGGTGACAATGACTGTGGGGATGGGTCGGATGAGCAAGTCGGTGTCTGCA
GTGCCCGTACTTGTGACCAGTACCAGCACCGGTGCAACAACAACAAGTGT
ATCCCGGCCCGCTGGCGATGTGACTATGATGATGACTGTGGAGACAACTC
TGATGAAGACGGCTGCACACCGCGGCCATGCTCTGAGAGTGAGTTCCAGT
GTGACGACAACCGCTGTATCCCCGGCCGCTGGAAGTGTGACGGAGACCAT
GACTGTGAAAACGGTTCAGACGAAAGCGGCTGCTCGGCTACCTGCCTGCC
AAACCAGTTCCAGTGTAGAAACGGACACTGTATCCCACAGGGCTGGCACT
GTGATCTGGACAGGGACTGTCTAGACGGGAGTGATGAAGACAACTGTGAA
ACATCAGAGTCCCCAGGAGTTCTGTGTAACGAAGGAGAGTTCCAGTGTAA
CAACACGCTGTGTAAGCCGCTGTCGTGGAAGTGTGACGGAGAGGACGACT
GTGGGGACAAGTCTGATGAGGAAGCCTTCATGTGCAAGAACTTTGTGTGC
CCGCCCACCCGTCAGTTCCGTTGCCGTAACGACAGGGTGTGTCTACCCAT
CTCCAGACGGTGTGATGGTTTCAGCCACTGTGACGACAACTCCGATGAAA
TAGACTGCAGAGCACCAGCAGAGAACAGAACGTGTACAGCAGACGACTTC
AAGTGTCTCTCAGGCAACAGATGTGTCAAACTGGACCTGGTCTGTAACAA
CTACGACAACTGTGGGGATGGGTCCGACGAAGGGCTGTGTGGTCCTCCCA
ATGTGAACGAGTGTCAGACCAACAATGGGAACTGCCAGCACATGTGCACA
GACCTGCCCCGTGGACACTACTGTACATGTAGGGACGGCTACACTCTGGG
GGATGACCTCACAACTTGTGAAGATATTGATGAATGTGCAGATTTTGGCA
GATGTTCCCAGATCTGTACCAACACCAAAGGTTCCTACCACTGTTCCTGC
TCGGCTGGGTTCACCAAGGCACAACGCAGCAATGGGGTGGCAACATGCAT
AGCAGAAGGTGATCCTGATTATCTGCTTATTGCCGACGACAACGCCATCA
AAAGAATCAACCCCGACAACATTCGCGATGGGTCCGGCGACGGTTACCGT
GGCAACGACAACACACGTGTAGAGAGCATGGACATCGACGTTAAGTCTGG
AACTGCGTACTGGAGCAACATCCACACCAGCAGTATCTACAAGGCAACCA
TACAGCTGGGCAATGGCAGAAAGAAGAGACAGGCTACTGATATTGCCAAG
TTGGATATCCATGGTTTGGAGGAGCCCCGCGGGATCGCCATAGACTGGGT
GGGTCGTCATATCTACTGGACAGACGCAAGGAAAGATGCGCTGGAGGTGG
CCAATCTGAACGGGACCAATCGTAAAACTCTCCTCAGCACCGGGATGGAC
CGACCGCATTCTGTAGCAGTGGACCCTAAGAATGGGTATGTGTTCTGGAC
GGACTGGGGCTTGTCTCCCAAAATCGAGCGGGCGAGACTGGACGGTTTGG
AGCGGAGGGTTCTTGTACGCGAGGACCTCCAGTGGCCCACAGGGCTGGCC
ATCGACTACCAAAACAGGCGCCTGTATTGGGCAGATGCCAAGAAGAACAC
CATTGAGAGTATTGACTTTGATGGCAATGGAAGGGTAGTGGCAGCCAACT
ACAGTAAAGGACTGCATCAACCGTACCTCATTGACCTGTTTGAAGACAAC
ATCTACGGGACGACGTACCTGACTGGCGAGGTGTTTAAGGTGGACAAGTT
TGGACGGGATAACGTCACGGTCCTGGCCAATAACCTGCAACACGCTTCTG
ATGTCGTCATCTTCCAACAGCACAAACAGGATCAGACAATTACGAACCCC
TGCAGTTCCTCCAACTGTACCCACCTGTGTTTCCGTGCGCCCATGCCTGG
TGGTGGCACCATCTGTGCCTGTCCCAACGGAGGCAACCTCGATGGAAACT
CTTGTCTGAATGTACCAACACCTTCTCCTACAGGACCAACAACGACAGCT
TGTGATCAGGCTGGGATTATATGTTACAATGCAGGAACCTGTATCACCAA
TGAAAAAGGGGACCCCAAGTGCAAGTGCCATCCGAACTTCCACGGTCCCC
AGTGCAGACTGAACAAGTGTTACCGCTACTGTGCGAACAACGGGCGCTGT
CAGCTGAACTCGCTGGAAAAACCAGTCTGTACCTGTGTTGGAGAATTCTT
CGGACCTCGCTGCAACTCCTCATGCGATAACTACTGCCAAAATGGAGGCA
CCTGTAGTGTGAGGGGCAATAGAGGAGTTTGTGACTGCCCGCTACCCTAC
GGAGGTGACCGCTGTGAAACAAATCTCTGTGACGACCGCTGTAAAAACGG
AGCGACCTGCACTGTACTCTCTGGCAGTATAACTTGTGTTTGTCCTGAGA
ACTTCCACGGACCACAATGTGAGTCAACAACAAACTTGTGCTTCGATTTC
TGCCAGAATGGAGGAAAATGCAGTTTAGATGATAATAACCAACCTGTGTG
CGCCTGTTTGAAAGGGTTTGAGGGCCAACAGTGTACAGAAACTGTTCCTT
CAACTAAGGGGGAACGGAAGGGAGAAGGAGGGGATGGTGGAACTACTGCT
GCTATTGTTGTGCCAGTTGTACTTGCCCTCATTATCATCGCTGTGATCTG
TGGTGTCTGCTTCTACCGAAAGAGAAGTTCAAGAACCATGTTCCAACACA
AGCGCATGACCAACAATGTGGAGATAGGGAACCCAACCTTCCTCTACGAC
CAGGAAGAAGACGACGAAACAGAGCAGTTAGACCCGTCATTAACCTTGGA
TCCTGACAAGCCAACCAACTTCTCCAATCCTGTGTACGACTGTCTTTACA
ACGAAGCTAGCGGCAGCTCGAACTCACTTACAAGTACGGAAGAGAAGAAA
GGACTTCTCTCTCCGTCCGGAATTCAGTTATACGAAGATCAGAACGACCC
CTTCGGCGGGTCGTCAGTAGCATAG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96923gene:BL96923Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96923_cuf21transcript:BL96923_cuf21-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96923_cuf21-E1BL96923_cuf21-E1-1564476830-122455Branchiostoma lanceolatumexon
BL96923_cuf21-E2BL96923_cuf21-E2-1564476830-122457Branchiostoma lanceolatumexon
BL96923_cuf21-E3BL96923_cuf21-E3-1564476830-122459Branchiostoma lanceolatumexon
BL96923_cuf21-E4BL96923_cuf21-E4-1564476830-122461Branchiostoma lanceolatumexon
BL96923_cuf21-E5BL96923_cuf21-E5-1564476830-122463Branchiostoma lanceolatumexon
BL96923_cuf21-E6BL96923_cuf21-E6-1564476830-122465Branchiostoma lanceolatumexon
BL96923_cuf21-E7BL96923_cuf21-E7-1564476830-122467Branchiostoma lanceolatumexon
BL96923_cuf21-E8BL96923_cuf21-E8-1564476830-122469Branchiostoma lanceolatumexon
BL96923_cuf21-E9BL96923_cuf21-E9-1564476830-122471Branchiostoma lanceolatumexon
BL96923_cuf21-E10BL96923_cuf21-E10-1564476830-122473Branchiostoma lanceolatumexon
BL96923_cuf21-E11BL96923_cuf21-E11-1564476830-122475Branchiostoma lanceolatumexon
BL96923_cuf21-E12BL96923_cuf21-E12-1564476830-122477Branchiostoma lanceolatumexon
BL96923_cuf21-E13BL96923_cuf21-E13-1564476830-122479Branchiostoma lanceolatumexon
BL96923_cuf21-E14BL96923_cuf21-E14-1564476830-122481Branchiostoma lanceolatumexon
BL96923_cuf21-E15BL96923_cuf21-E15-1564476830-122483Branchiostoma lanceolatumexon
BL96923_cuf21-E16BL96923_cuf21-E16-1564476830-122485Branchiostoma lanceolatumexon
BL96923_cuf21-E17BL96923_cuf21-E17-1564476830-122487Branchiostoma lanceolatumexon
BL96923_cuf21-E18BL96923_cuf21-E18-1564476830-122489Branchiostoma lanceolatumexon
BL96923_cuf21-E19BL96923_cuf21-E19-1564476830-122491Branchiostoma lanceolatumexon
BL96923_cuf21-E20BL96923_cuf21-E20-1564476830-122493Branchiostoma lanceolatumexon
BL96923_cuf21-E21BL96923_cuf21-E21-1564476830-122495Branchiostoma lanceolatumexon
BL96923_cuf21-E22BL96923_cuf21-E22-1564476830-122497Branchiostoma lanceolatumexon
BL96923_cuf21-E23BL96923_cuf21-E23-1564476830-122499Branchiostoma lanceolatumexon
BL96923_cuf21-E24BL96923_cuf21-E24-1564476830-122501Branchiostoma lanceolatumexon
BL96923_cuf21-E25BL96923_cuf21-E25-1564476830-122503Branchiostoma lanceolatumexon
BL96923_cuf21-E26BL96923_cuf21-E26-1564476830-122505Branchiostoma lanceolatumexon
BL96923_cuf21-E27BL96923_cuf21-E27-1564476830-122508Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000014genomeSc0000014:4099497..4127675 +
Properties
Property NameValue
Transcript idBL96923_cuf21
Biotypeprotein_coding