Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96890_cuf5 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96890_cuf5
Unique Nametranscript:BL96890_cuf5
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96890_cuf5

>transcript:BL96890_cuf5-protein ID=transcript:BL96890_cuf5-protein|Name=transcript:BL96890_cuf5|organism=Branchiostoma lanceolatum|type=polypeptide|length=3498bp
MNCHLIKGSGVIATNGGAGSSHNSYPAGGGAGGRIALYFRDNATSTGFSY
QSHGGACGDDTPDSECEGGGPGTIFLYHLHHEHRTLIVENGGHEPRKKAI
DWDNLDKDGCRGWILPDSGRHYFASYGHDYHFEELQIDEGAHLAVLSPTH
QQALYDENVFTSTMPYNVSMFFQYMIGDRTGAVHIATGQEVELHRPEIDL
PFSVHVYYGGYLGLAPVTEVHGVEIHLAGVLAHIQNLTIHHGGFLWLQHG
GRTLLEDFSHYSFQFVRVQDDGRLNATTDPIVDPGITFITQAFFVEGGGI
MHGTRLTILAENITVDSGGRIAADGLGYHPVHSNDTHGHLSLHGEVNLGI
PDDVTGLGSGAGHGGSGGRGTLNDGHGAGFAYGDLYEPYVFGSAGGHGLI
INGKRAYGGTGGGVIWMNVTGTIDIDGEVTANGGEADGNGGGGGSGGSIW
MYCNIIKGYGRIAANGGRGSNHSSSPGGGGGGGRVAIYFINNQTATGFNY
HAKGGRAGDQTLAENGGAGTAFIYHMVYTHRTLIIDNGGLEPKDKFHIIP
DYTDVTTDGCRTWILPQSGQHFFANGTHDYHFEELQIYGSAHLAILTHPV
GLNASLFFLYMIGDRSGTVHLGMNQVMDLHRPEIDLPFSTRVYSGAYLGL
APITMIHNVSIWLHGVLDHVEDLTLHHNGLMSLEHGGRTEGMEASYYNFD
IVLVQDNGTINAITSTTEEPGITFYTNATVIEGGGRFHGTRLRIYAENIT
IDDGGLLDADGTGFAYSDYNRTAEINIGIGQTSPQGSSGGCHGGTSGRGV
GTPVTGTPYGHLYEPFLFGSAGGGERAGGRGGGAIWFNVTGVIQIDGEVR
ANGEDAHERHGGGGSGGSIWMNSYIFCGRGNITANGGAQYHDQGTGGGGS
GGRIAVYFRENITYIGTYQAFGGYAEYKGSLTAEQQGEPGGPGTVFLYHL
HHEHRTLLIDNNNLRSKNVGPIANYSDLSQDSFKAWILPQAGEHFFAAGN
HDYHFEELQIYGNSHLAILTDPVDRGATLHFLHMIGDRTGSIHVGPNQVM
DLERHFIDTPFNSFVYQTGYLGLAPDTELNSVFVHIEGTMDHVHDLVLIN
GGELRFFLTGSTNQMSRLNYRFNGTVTVKARCAINASSPFAHPEQYNLTA
GKLIVEGGGTVYSKNMKILAEEMEVDDGGLVDASDGGYLSELGPAPGTQH
RLGNSGGSHGGIGGRGGCGGYKTCRLRRNLPYGNLFYPAEFGSGGAGDRG
GIGGGILDIEVKRMLKVDGDITANSRDLSSSSSLNGASGGSGGSILITTG
ALTGGHTGHIQALGGAGDPSNGGSGAGGRIAVYFSNNITHAFYAGTFDVY
GGDVGALAESGASGTVFLKSKESGNTTLRVDNNGRASTNHKISNIGERLD
LSPETMSRVSSYTSRGGVSVTSTSNSYRCCYPHYNPPDWYWLPYLFDQTF
HTDQTQYFLADSSSAVLTFDLNNVYFVNTIRVFINCACRSKFKVETENNT
ITTAVTSDYVLPSSTCRQGSYVNLPVRREAQTVKLYVTGTSACHGSNLAS
LSEVEIYVNGQNLHDRYRYRELDSAKTWIEPGSGTNQYTFDQLHLLGDAE
LAVMPGNGLTTPVNMQINRLHGDKTGWLHVGYEQDFAVDVTDPDVPINTY
VYEKGELEYPSRAFFYQTVLRSSGKIRGIDDLYVFDGGSVYVDTNGSIGV
NTPGHISLSSLHVQDGGTFQMFSYDKHIGMDIQLTNLTVYGGGHLVSNDR
FNVTAEHLVAIYSGGRINLDHGGFFTKETRGSGFETSEGPGQGYGNSAGG
SGGGHGGSGGRGKGQANVGLAYGSIYQPVDYGSTGGYGSDYGQLYYGDNE
HGNAVVRRGLGGRGGGALKITTRHCLIDGRITANGESIDGVHNSLAGGGS
GGSIWLECEELDGYGAVSANGGTGHGSGGAGGAGGRVAIYSQKLQKFNGT
VTAYGGNSNYEVGGSGTVYIEHQNALQEAQHKSLKINNNGIPYPHAATYQ
HGDLRDLLDGSYENISQSGGITWLYHNSHSYVFDELHIHGNAHVAILSNT
STDVVEVQGGRLLGDRTGVMHVGKNQTFGFDDVDIYLPVNTQLYRYGHLE
LSQRLSMREVWMEVNGTIANIDDLTIESGGELHLWSYGNTRGKPSGSYEC
ANISVRADGKMEMLSVKNDSRIDVTVTSLVVNAGGYVRTNDLKLTAVNAT
IDVAGDFHADMSGHSAEEGPGAGRYESYGGSHRGSGGGHGGRGSRSYRGI
YSGFAYDSMYSPRLPGSGGGHGGSGDAGGRGGGVVHLDVMDTFRVEGRLH
ANGESGTRSGGGGAGGSILLTVGHLDGTGSVEVTGGSAPGPGYGGAGSGG
RIAVYYRNNYTYDGEYKVHGGQDKAGHAGGGTVYIEGINHNNLTHRTLRV
DNNQGSSPEPRVQEVQQISLAGPTLTGHIEFVSYSGVTVQTTGPAYHTGT
SPNVYWHSLSRIQAPSSSSYYRSTTGNPTITLTFPFTLYIDHLRIFPMCI
DSLTTAFKVESEYQGQIYNHTDGYIETLGCGTQQEVDQYAVVQLGRDVQK
IYVKLDARGSSGDATMDAIQLFARENPNIASQLPFTSAPGSAWVVAEEES
SYHFEFDEIQVRGGGGVSFEGEGSRLSVDRVTGDYTGLVTMREGQMFHNR
FSRDILPFSLVVHRGANLTLPPRTECKDVDIYIRGHFDTIQNLTVGSGCK
FVLDHLDPTTTELDHVVVKTFGEMEVVTRNEVTTTLTGQTFSIRSGGMVR
SNDLELHYINVTVESSAHLTVDEGVSRQEASGDGTGVGSPSGSSGAGHGG
NGGQGYSQSMVGITHGSFLIPNTFGRDGGHKVFPHLGGRGGGRILVNISN
ALVVDGFLTAKGGKWGSVAAGGGSGGSIWIETHIFDGDGVVDVSGGDGYM
GQESTAGGGGAGGRTAVYYTHNHFIGQFLATGGDGSEPGGPGTVYLHRLQ
PDNQTQLLDATSEEAQVTHDSNVTQPLTNRTLYINNLGKRPRDPHRNLSS
LYTSYASTSTIAWILPEDLSEIADRNIPTHYFLEDVIIDELHVYGGAHLG
FLWPVGPREHLQIRLGSLHGDRTGKMHIGFNQTLYAANAHLPMDLTIYPG
GLATTHGELRAAGVTVDVQGVVANCENITVVDGGIIKMHEMIDLDGHPTE
TFNFNAIKIRNHGTLQTSNGQNQRVMKGTFVQVHGGGVITSTNLHLLAEV
IIVDVKGSINVDGSGHSAGVGPGAGLTHANRGTGGSHGGSGGAASASQET
GPAYGSFLLPQEFGSGGGNSGGAGGGSLFVNATDFVRIEGVLSASGQDSP
GEYGGGGSGGSLQLTARKLEGTGKIQVNGGSGYGGGGGGRMALYFELMDF
DGSLESSGGEGQAEHGASGTVFFKEQHSVEKTTLRIYNGYNQPSRRTWIP
LPEDQADDHILDVLDIGGYAHVGLLSVDEGGLPVSDSRTLHVRDLAGDHT
GTVHVDRGESINISLNATHKIPFNVNVYANGTVGLPHNTYLQDTTLTL
Run BLAST on NCBI

mRNA from alignment at Sc0000048:1895029..1926373+

Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96890_cuf5 ID=transcript:BL96890_cuf5|Name=transcript:BL96890_cuf5|organism=Branchiostoma lanceolatum|type=mRNA|length=31345bp|location=Sequence derived from alignment at Sc0000048:1895029..1926373+ (Branchiostoma lanceolatum)
ATCATTCTCAACGGTGTTCTATCCCATGTGCTGAACTTGACCCTGCATCA TGACGGACATTTTTATCTCAACAGACATGGTAGGCGCCATACTTCTTTGT TTAGCCATTCCTCGTTGCAAACCAATTGTGATTTTGAATTTTGCTATAGC CTTTTTCATGGCAACTGTTGTTTTTGTTTGTCTCTCTTCTAGGCAGAACA GCAAATGAGGAAGATGATGAAGGGCTGTATGTGTTTGATGTGGTCCATGT ACAAGACCAAGGATACGTTCACATGATCTCAGACCCTGTCAGTGAACATG GCATCACGTTCCACACCAGAATTCTGCACATAGATGGCGGAGGACTAGTG GAAGGGACGCATTTGTATGTTCACTCCGAAAATATCACCATCGATGATGG GGGAACGTTGTCCTCTTATGGGAAGGGATACTCGGCTGATGATGGGTCCA GCCTGAACCCAGATGGTTCTTATCGCAGGGGACTTCACGGCATCATCAAC ATCGGTCTGGGCTCTGTGGAGAGCTACAACGCGGCCTCTGGTGGTGGACA TGGGGGGAGTGGTGGCCATGGAAAAAGTAATTTGTCATCTTCTGCAATTG TTATCAGACTACTATTTGAAAAGGATTCATACCATTTCTCTTCCTGCATA TTTATGTACACTGTAGCTCTTTTTTATTGACCTGTTCCCTGGACCATTCA TCATGACTATAATGACAAATAAGTCAGTAAAAAAATTGCACATACATGTA TGCTTGATATGTGCCTTTTGCATGCATTCAGACCAGTGCAGCATCACAAA TAAGCTAGGGTATTGTGTCGTCCCACAAACCAGTGATATTTATAGTTCTT GGTATTTACATCATGGAGTCACTTTGCATTTGTTGTAATTTCTTTTGTTG CATTGACATCTTTTGAACTATTGTATATTGTATTCATAAATTATGGTTCA TCATGTTCTTTGTAGACACTGAACGAACTGGACAGCCATATGGGGACATC TACGAGCCTGACCAGTTTGGCAGTGCAGGAGGGGGAACAGACGGTGGGTC CGGTGGTGGAAGGATCTGGTTCAATGTCACCAACACCATCCACATTGACG GCCTTGTGTCTGCCAACGGTGGTGATGGAGATGGTGAGTGTTCTCCTTGT ACTGCTTCTTCTTTGGACGGGGTAGGAGTGTGAGACTATTTTGATATCTA ATTTAGTAAAAATAGCCAGCGTGCCCCTTTACAACCTGGTGTAACAGGCC AGAACACATCCTTGGCCAGATTACATGTATATCCCAATTTTTATATTTTG GCCTTACACTACAGGTAAGGGTGGCAATAGATTATGATGAAGGTTTATCC TTAAGATTTTCGGTTTGATATGCTGAGAAAAGTTATTCAATGTAGTTTTT TTGGTTTACTGTCTCATATTTTTATTGATTTATTGTCTCATTTTCTGCCT ACTCTACAACCAAAGATGTACATGATTGTATTTGCTTTATTATTGTGTCA GAAATAGCTGTAATCTAAACAACCTTTCACAGATGCAGCCTATGNGCTGT AATTTAAACAACCTTTCACAGGTGCTGCCTACGTGTACTTTCAGGGTCCA GTCCTAGTGGAGGAGGCAGTGGTGGGAGCATCTGGATGAACTGTCACCTC ATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCA CAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACT TCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGG GCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGG AACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTG AAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTT GACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTA CTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATG AAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTAC GATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTT TCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGC AAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCAC GTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGG AGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAA TCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTG GAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGG AAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTA TAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGA CTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGC GGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGAC ACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACT GGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGTAAAT ACTTGTATTTCACTTAATCAGCAACTTCATATGGCAAGGTCATGTCAACT TCATGGGTGTATGACACAGATACAGCTTGAAACAGAATAGGGGGCAAGAA TATAAAGTTAGTATGAAGCTTGTTTCAAACTGATTCTTATTTACTAACCC TTGCTGTCCCAGAACCAATGAAAACAACATTTTGAAGATTGTTATTGGAA TTGAATGCAAGATTTTTATCTAGACATACCATTTTTTTCATGATGACAGG ACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGA ACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCA AGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACA GGGACAATTGATATTGATGGAGAGGTACATGTAATGTTACTTAATCTCCT ATTAGATCGAAGCTTGACAGATGTAGGAATGTGCTACAAAATATGCAAGA CCATGTAAAGCAAATAAGAATTAGAAGGTATGAATAGTAAAAAACTCACT CTCAACCTACCTTTCTAAAATATTACAAAGAGACAAGAAGAAGCCAAACC TATGTATAAGTTAGAGTAGTTTTAGAACAATTAATTGTTTTAGAGTATTA TTAGAAGTCCTGTCAGTGTCATTATATGTACTTTACCACAAATTTTGTAT CTGTATGCCTGTACTTAGCCCAATGGGACATGAATGTACAATAGATAATT ATTATCATTATCAAATAATGATAACTGTGTATTACTTGTGCTGCAGGTTA CTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGA GGCAGCATCTGGATGTACTGTAACATCATCAAAGGTACCTACCATGGAGA ATCTTACATTATATCAGCGCATGTTGTGGAAAAGAACAGTATCACAGTTC AGTTGCCATGGGTATCTTGCCCTTTGGAAGTCAATAGTTTACGTGACTGT GCAATAAATCTAATAGTATTTTCAAGGCATGCTATTGGCATAGTATAGGT ACATGTGTACATGATAGACATGGAGAACATCCTTTCTCAAAAGGTCTCTT TTCTCACCCAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGA ACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATC TACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGG TGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAG CTTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAAT GGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGA CGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAAC ACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATC TACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGC AAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATC TTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCG TTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCAC AATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGG AAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGG AGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGT CCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAG GAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTC CACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGG CGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACA GGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCC TCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGT GACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTG CAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTC AACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGA GGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGA TGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGG GCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAAT TGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCAT TTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGA GAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACA TCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCC CTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATC CTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCA TTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTG ACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGAC AGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACG GCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATC TAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAG GGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCT GAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACC GCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGC AGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGAT TGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAG AGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGA TATCTGTCTGAACTTGGTCCAGGTGGGAGAAGCTGTTAGATTCTAACAAC TTGAAGGAATTATAGCTATGAAATCTGCATACCTTGGTCAAATGTTAAAG GCGTAGCTGCAACTCCTTTGTGTTGATCTACAGAAGTGTAATCTGTACCA AAGGTACAATGTAACTATGTAGTAGTACTACAATACTACAAACTTTAAGT TTTGTCATCTCAGTTTATTCAAACAAAATCCAAGTGCACTTAGGGACCTC TTCTTTTTTGTGCCTCAGTTTCGGAAATAATAATTTTGCTGATGAAACAT CAGTGGGTACATGTGATGCCTGAAGCATGTGGGCTCATCTGCTGAGTTCT CGAAGTTTGTGAAATCACAATAAAATAATCTGTCCAAGATTATTACTTGT CAGTAATGATTGCTGTTGATTTCCCTCCTATAGCCCCAGGAACCCAACAT CGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGG TTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCA ACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGA GGCATCGGTAACAACAGCTGCTTTTATTGTTCTTTTATGTGATGTTGTTT TATCCTCATATAATGGTAACACAAACAACTTCTTAATAGAAAATAGTAAA TTAGCCAAACAAATTATGATTATACTTAACCTAATTCTGATACGGTCTAG ATAGATCAAACTATAGTGTATACAATCATGTTGTTTGTTGATGTTTTATT CCAGCATATTTCCTCACTCTTAGTTGCTTTGATTATGAATTACTGACATT CTTGTAACATAGACGGAATTCTCTGTCTGATATTATGATGATTAATTTCA TAGTTTGTTGTGAGAAGTGTCTAATTGATGCCCATGATCATGTTATCCAA AAGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGAT GGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAA TGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCAC TTACAGGTCTGTGTGCTTGATAAAGGGACATACATGTAGTGTTAACATTT ATAGTGATTTTGCTTATGATGTGGCTTTGTATGCTTATTGGGGAAAACCC AATGGCCTTCAATGATGAAAAAAAACCACCAGCTTGTTCACCAAAATTAA TTTGTTGTTCATACAGTTTTTGAATATATTTGTCTTATTCCACAGTACAT TAACGTTACATGTGCTTGCATGTTATCTTAATGATAACGTAACATTGATA AGTCCCTGTGGACTAGGCCAATTCTGCACAGAAGTCTTCAACATTTTGTG CAAACCCACATTATAAAGACCAGTTGTAGTTTTCACTGGTCAGTTGGTAC TCTCAGATGAGTTTGTGTGGATTCAAGTTTTTATCATAAAACTGGTATAT TCCTTAATATGTACTAGTAAAGGTTAAAATTTTGTATTTTGTGTATGTTA ATTGTTTAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGA GACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTT CTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATG GTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTT CTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGG AAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATC TGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGA GTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTA TAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCC ATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTG ACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCAT CAACTGCGCATGTCGGAGTAAATTCAAGGTAATGTGATCTGAGAACATCA TTTTCAAAGTGGTGGATACATGTATCCTGGCAGATAAATGAATGCAGGTT ACATGTAATAAATACATTGTGTTTATCTTGTGAGTGTGAAGTTTTAAAAC AGTCTACTTTCTTTTGATAATCTTCATTCTTATGTAATTATCATTTTAAT GATATATCATGGGAAACTATAAAAAAACCATGATCATAACTAAAATAGAG TGAAGTCAATTGTTGTTGCTAAACATCCTCAACAAAATGCAGAGTCATTT TAAATTTGTTTAAAATGGCATGCAAGCTTTATGTCAAGTTGTTCTAATGT GTGCCAAGAACCTTAAATACAATGTACGTTATCCGACATTTTTACCATTG CAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTA TGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTG TCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCC TGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAA TGGCCAGAACTTACATGACAGGTATGTATATGTATGACATGCTTCTTAAG TCACTTTATGCTCCAGAATATAAAGCTGTTGCATTGTAGTTCGTATCCTA TTTTAGGTATTAGATTCATTTCCAAAATCCTCTGATTAGCTCCTTAGAGT GAATAGCTACTACTGAGATTTGATGATAGTGATTGTAATATCCATCGGCA AGTATATCATCACTTGCAAATGATATGCTTTCATTCCATTGCATTGAGCA ACTGCCTGAGGTATTTGTTGTAGTTTTGTTGCACTTTAATCAAATGGTTT TTGTATATTAATATGTACATTTTGTATTTGCTATAATTTGTTTTTAGGCT TCAGTTCTGCTTAAGGCTGCTTGATATTCCATGTCATGTGATATTTGGGA ATTTGGGAACAAAAACTTGCTTCTTTTGATGGGTAGACTCCAAAAATCCC CAAATCAATGTTTTGATGATTTTGTAGGTACCGCTATAGAGAACTGGACA GTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTT GACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAA CGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACA AGACTGGTCAGTACTCCACTCACTGGTAGACCCACTGCTTTAAATTACCT TTTCTATCTGATCTACTTTCTTAATTGACAGAGGTAACTGTTTAATGTGG CACCACATGTACAACAAACATCAGATTTTGTTTCTCCATGCAATTGGGGA TCCATGACATTGTAGGTTTAATAGGAACTGGTCCCTCTCCTTGGTGCTGA AAGCCATTCACCTTATTTAACAGTTTTGTTTTGAATCATTTTCATATTGA CTCAGTTTCTTAACTATGTTCCTGTTGGACATTCATACTAACACTGCCTC TCTGCCATGTTTGAATCACACTTACATGTAATATTGTGATAGATTGCTTG GATCATATTCTCTTTTATTCGGTTTTCAATGAAATATTACTACCATGTGG GGCATTTCATCAGCCATATACATTATAACAGCATTAGTCAAATAAAGTTA TTCTTGTTCAACCAAACAAGTAACCATTAGAGTATTTGCCATGGATTAAA CTAATAATCTGAAAACAAACTTTCTTGAATATTGTATACGGACAGTGAAG AATCATTATGATCCTGTTTTGACATTTTCAGGCTGGCTACATGTTGGGTA CGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACA CTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTT TACCAGACTGTGCTTAGATCTTCTGGCAAGGTAGGATGCCAACTCAAATT ATTACAAAACTTAGATATCTACATAGTCATATGATTTTGCATTTTATTTA TTGTATTAACGGGTTTGTTAAATCAAGACTTGAGTGTATGTTTTTTCTGG TAGTTTAAGAATTTTGTGAATTGTGTCATATAAAAATCTAAAGCTAAGCT ATATTTTGTAACATTGTTATTTTTGTATTTTTCTAGATCCGAGGCATAGA CGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCA GCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTT CAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCAT GGACATCCAACTGACCAATCTAACGGTAGGACACTATAGCATAGATTGTC CTAATTCAACCCTTTACATGGTGCACAGGCCCATGATGTTTCCTGATTAA AGTCTATGCTAGATAACTAGGACTTGTTTTTTGACAATTATGAAATTTCA TTACTGTAGATCTTGAAGAACATGTATTGACCTACATGTACATGTACTAG ATCAATTGTGCATTCCCATATATGGCAAGTAGATCTGTGACTAGTCCAGT CCAATAACATTAACATGTTGATATATAATTGTACGTGTTGCTTCAGGTAT ATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAA CATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGG CTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGAC CTGGTCAGGGTTATGGTAGGATTAAATTTGATACATTGTTTTCATTAGAC AGCGATAGAACTTGCTCATATATATAGACGTTGAAACAAATTTTTATGGC CTCCAAAAATACATTTTCTTTCATCAGGATTTTTTCCACCATCATTTCAG AGGATGTACACGATATTGAAAAATAAAATAGATTTTAAAAGTTGTAGTTT TGGTCGGGACTGGTTTTGTCTCTGTGGAGATATCACATTGCAGATTCTGC TAGCTACTTAAAAAAGCATCATGCTTCACCTCAACAGAGGGTGACTGCAT TACCTTTTCTTACCTTGCCTGATATACTTGCTTGATTTGACTGAGTAAAG TCTTTAATTTGGCACTACATGTGTACCAAACATCAGATTTTGTCTCTCAA TTATGTTTTATATTCTTTAGAATTGGTGATTCTAATCAACATCATTCTAA TTATCCAGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTG GAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATC TACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGG TGAGTTTAATTGGGCTTGTACATGGGAAATATCTTTCCCATGTTCCAGGT GGTGTTACTTGTCATGTCTAATATCTAACAAAGCTTCAAAACTCTTTTGA GAAGCAAACAGTGCATAATCATCGTTAATCACATACATTTGTACATACAT TTTACAAACATACATAAGTTTTCATACTGTTTGCTTTTCTACTTCTCAAA AGAATTCTTTTGCAAGTCGCTGTGCCTGATTCCGAACCAACTGCCATGTT TACTATGACGTCATGGGCGGAAATTAGATTCTTATCTGTTTGCAAGAATC AAGAACTGGAAGTTTTATTTGTAAGGGCTTAGATTTGATGTTCAATCATA TCAGAAGGGTGTATATTTTGTAGAAACGTCTGTGCTCATTGAATAGTACT GTTATGGCTGAAGAATGTAATCAGGAAATGTTGAATTTTGGTGACATAAG CACTTTAACTACTAGTAGTGATTTGTGTACAAGCTGACAGTATTGTGCCT TGCTTCACAGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGT TGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCA CCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATT GATGGTGTTCATAACAGCCTAGCAGGTGAGAAATTTCAATTGATGATATT ATCAGCTTTTTCAAAGAAAACACTAAAAGGAAAAGAAAACCTAGTTATCT ATGTCTTTTAGTAACTGTTGTGCAATGTAGTATTTAGATATTTTGCCAAG AAAAGCTCATGTTGTTGGAGTTGTTCTGATGCACATGTATACATTATAAT TCATGTATTTTTAGGCACCCAGGAACTGTCACACACACACATTTTCATGC AATGTCATGCTTTTTTTACCTCCATCAAGGAGGGTCTGGTAACCTTCTAG ATTTACGATGCACATGTATGTTCTTGTTGAAGGTGGTGGCTCGGGTGGAA GCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCC AACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACG TGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAG CTTATGGAGGTAAGCAGATTGTCTTCTTAATATGCACGTGAATAAATACA TAGTCTAGTATGTGATGATTATATTCCGCTTTCATGTGTGTGTCAAATCT ATATATCTTTTCGCTCATGATACAGGGAACAGCAACTATGAAGTGGGTGG TTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGC ATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCA ACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAA CATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCT ATGTTTTTGATGAGGTACAGTATATCTCTTGAGTAATAATTGTAAATAGA AGGAAAACAGAATTGTTAATTAATTTTTTTTACCATTCAGCTTGGCACAT ACTGTAAAAAGCATTTTTGCCAGAGTGGCATGCAGTGCACATTGTGTGTG GTAAGAACTTCTGGGTTGGAAATTTCTCTCAGTCAAAGTCTTCATGGTTT TTCAGATTGTGTGTTTGTGTTTCAAGATACCACATTAACTAGGAAATGGA TGTTATGAAATTGTTTTTGAGAAGGATAGTGCACAAAATTGTCTTTTCAC TAGCAGTCAAAGGTCATTTGACTTTTGTTGGTTGTACGACTGCTGTGTCA TTATCATTAAAGCAGTACAGTCCAACTTCTTGATGATTACATTAGTTTTG AATGGTGACTTATAAACAAATCTGTATTGAAATAATAGTTACATTATTTC TGCACTGTGTGATGAAACAGCTGCACATCCACGGCAATGCCCATGTGGCC ATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTT GCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTG GATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGG TAATCCTTGATTTTCCTTATATGCTGTAAATCCATTAAATTTTGATATTG CGGTGGGGGAGATGGAGTAGTTCACAGCATTTGATTTTAACGGTGGAAAT AAAAATCACTGTCTCAAATGTTAATAATCATATGTTTGTGATCATGATGA TATTTTAGCTGTTGACTAGTGACTGTTAAAGTAGCAAAAAGTTACTGTTA ACAAATAAAAAATTACAGTAATGTGTCTTGTAGTCAGTGTCCTTTGCCTT ATTGTTTTTTCTGTCTCATGTAATATTGTGCTGAATTTCATCCTTAGGTA TGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGG AAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGT GGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGG TTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGA TGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTT GTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGC TGTGAATGCAACCATTGATGTAGCAGGTATGATGCAGATATATTATGAAT GATAATTTATGTATTCTATTATGTAACATTGTACTTTATTTAATATACTG TATTTTATGGGACCCAGTTTTGTTTGTTCATTTGACTTTTATTGCAAAAT GTGATAATTTGCACACTTACACATGCACACTTCTTCTTCTTATGAATAAT CATTTCTCTTACATGTTGAAACCTTCATTCTAAGAGTCTATTTGTAGTTT TCCACATGCTTTTCTTTGCTGACGTATCAATGCATTGTAGGATCAGGATC AATGAATTAAAGTTTCAAACTTAAAAAAAAACAATAAATGAAAACCTGGT ACAAAATGGATGCAAATTTCATTTAGCATGCAGTAAAATGCAGCACAAAA TGATGCAGCACCGTTTTGTAGAGATTCCTACCGTCGGCTTTCAAAGATGA AGTGTATTTCAGAGATAAGTTTTCTATGCCTCCATGGTGCTGAATTGCTT TCCATTGGCAATAGGATGATAATCATGCATACTACATTCATTAAAAGTGT TTTCCGTCAATTAGTGTCTTCCTATGACTTAACTGACACTGAAAACACAT GATTTGTACATTCTGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCA GCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACA TCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTG GGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCT GGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGG AGGTGTGTACACCAAAACTGTGCTGTAGATACAGCTGGAATTGGTATTAG TAGTCATATTAAGCAAATGCAGAGTTTTATCTAGAATATTATAATGTAAT AATCATAGACCCTAGAAATCCCCACAATGCTTATTTGTATATGACCCCAT GCAGGTTAAGATGTTATTAGATAGTATTCACAATTGTTATTGCTTTTAGG CTTTTGCTTGAAATTTCAAAATGGAACAGTATAGACACTGTATTGATGTT ATTCTAAAGAGTGATGTGACACTCACAAATGTTTTTTTCTGCTTTCAAAC CAAAAATGACAACTAAGACTTTTTAGATCTATGACTGTCACGTTATTTTG GTCTGTAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAG GGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGG GCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTC TGTGGAAGTAACGGGTGGTTCTGCACCAGGTAACCAAGTTGTGTTTGAAG GTGGATAGTTGTTGTAACAGTTAGATGTGCAAGGGTTAGGTGTGACAGGT CGTTCACTGACTGTGATATAACCAACTGCTACTGCGCCGCATGCCTGCAA AGTTGGTGTGTTACATTGTAGGCCATAGGGCTTTGGATACGGAATACAGT TCCAAACAGGTATTAACCATGTCACACATGCTATGTGCATACAATTTGAC CCAAGAAATATTGTTGGATTGAATTTTGACATTGTGTTGTAAATCACTGT AAAGTGATCATATACTGGATGATCAAATGTGTTTGTGTTTCAAAGTTCCA TTCAGACATAAATATGCATCTGTCTGGTTTGGATTTATTTATGAAACCAC AATGATTTTAGAACCGAATAATCTATGCTTGGGCCACCATGTTCTTCACG ATGTGATGTCTGGTATCAGAGTGAAATGGCAGATTAGTTGGCAGAAGTTT TAATTAACTATGAACCACACATTACTTTTTTTGTATTTCCAACACCAATC TCAGTGGATGTAAGCTGATCTCAATTGCAACTTCTGCCATGCACTGCAAC TTGCCAGGAGTGTGGCAATAACTGCCATCGGTTGGATGGCAAAAGTACAA CTTTAGCAGAAGATATGATCAACCTCTATGCAAAACTTTTGATACAGGGC CCACCCTGTTTGAAGAAGTTGGCAGAATTTGAAGTTACAAGTGATGCCAA GTCTAATTTCTGCCTGCAGGACTGGGAGGTTGGAAGAAATACACAGTTGG CAAAAGTTCAGTGATGTGAACAGATAACTTCTGACTGACTCTAGCATCGA ATTCCCATAGACCCACAGATAGACAGTAGACAACTTTTAAGAATTAGCAT CAATGTTCACACCACATTCTACATTATGTTCATACCATTGAGAGATGTCA CTGTTTGGGTGTGCTCAGAAAGAGTTCCCACACAGAGATGGTCATGGTTC TGTACCTGGTACTTGATCGAAAGCGAACATCTACATTTGTATACTATTTA TTAGGTAAAGGGGTATGAGCTGAGAAGGTGGCTTACATGTAGTTTGCAAA GTTGTCCTAAAAAAAGCTATGACACAAAGACTGCAGGTCATTTCTAAACA ATCATCTATATCTGACTGAAGATGTTCATTTGTATAGTGTATGAAGCATG TATATTTGTAATAATGATAATAATGCCCTTTGGGGTTTTCAAATCTAACT ATTAAATCATATTTTACCTTCCTCTAGGGAATACCTTTTCTTACCCAACA ATGATGACTCACAACCTAAAGCTCAATGTTGCAAATTCTCCGAGTGTTCA TCCTTTGACGTTGGAAATCCTTTCTGACATTTGTAGAAATTTCTGCACGT TAACAACAGTATCTGGATTTAACACAACTGGGTAAGAACAATTAGATAGC AGTTACTACATTATATTAGTCCTACATGAAAGATGTGATCATGATATACT GTTGATTTCTTATCAATGTACAAAACAGAGCATCAGCAAACAAAAGACAT TGTGTCTTTTGAGTCAAATGAAAATCTTATGAGGTCTTATTTTCTAGAGT TTGCTTACACTGTTGCATCCCATAGCAATGACTATGTGATACTGTATTCT TTTTGCATGTTGACTTTACACAGATATATGTAGGGAGGTATCTTCTAAGC TACACCTTCTATCACATGAAATACAACATGTATGTGCAGTGTGTCTTCCT AATCATGATTCCAAGATAAGTTTATTTTTCAACATGCTCAATGTCAAACT TTAGGACCACATACACTCGAACCTTTCCTGCCATCAATTTTGGCCATCCC AGGCAGCTTCGACTTACACTTTTAGGAGATGACTGGCTTGGACTAAACTG GGTAAGTTGATGTATAAACTGCTTATTCAGTCCATTCTGCTTCCTAACTT TGAAACTAAATACATTTCTTTTATGGAGATATTACATTCCTTGCAACACT TTTTCTTTATAGATAAAAATCTTCAATGCTTATACTGGGCAATACTATCA TTTTACCTGTCCTCGCAATGGTGACTACCATTGCCAATTGTCCACGGACC CTGGTGAGGGTAGGCCACAACTTGTCTTGGACTCTGATGGTTAGTACATG ATGTCATGATTGTGTATTTTTAAAATATAATTCTAAGGTTGTTTGTTCAA GTTGCAACCACAAGCCTTTCTCCTTGCTTAAGAATGTGTTAACTTAAACG TTTAGGTAAAGTTGCATAAAAAAGCATCCAGAAAGTGTACTTCTTTCTTA GACTAGTTTTCTACTCACTAATCTTGTGAGCAAACTAATTTTAATTTCTG TATTCAACAGCTGTTTCTTCTAACTGGTACCAGAGTGAGGTAACTACAGC CTTGACTGGACAGACATTTTCTATTCCCAGTGGAGGGATGGTAAGAATAT GATGAATCTTCTTTTCAAATGTAGTTAATATGATGCAATTTAGTATTCCC TGTTTCTAGCATGATGTTCTGTCCATAGGACCTACATGTAATGTTACATG AACAAATGCATTGTACAATTGTCATGTATACAAATTATGTAGCTCTGTTA TCTTTGTCATAAAAGATGTCAGGAATGGCCATGCAAGAATATAGACTAAG TGACATAAGAAGTATAAACTAATCATGACTCCTTTTATTCTTTTACACCC TACGTCTATCCATTCTCTCTTACTTTCACATCTGCCCCTATCCTATATCT TATGGGGTCAGCGGGCTATATGAAATGTAGTTTGTAGACCAGTGATCACA TCACAAAATAATCATGAACAAAAGGATAATGCTGCAGACTACATGAAGAT AAATTTATATTCTAATCTGAGATCACAGAACGTAATATTATGTTTGATTT TGTCATTTTCCCATCAGGTGCAGTCAAATGACCTTGAACTGCACTACACC AATGTCACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATC AAGGCAGGAGGCCTCTGGCATGTCTGGTGGTATGTGTTCTGTTTGACATG TTTCTATTCATATTTGACTTTTATTGTCACTGTGATAACAACAGTATTGG ATTTCAATATAATGTTAAACTTAAAGTTATGTTTTAACATTATGTATAGT ATCAACTTACTAGTAAATAATATTGTAGTACACAACATATTTTCAAATAT GGGTATATTATCAGAACGTCAACACTTATTGATTTATTTTTTAATAGAAA TATCATAATTATAACAATATTATGATAATGATAATAATGCCCTTTGGTGT TTACAGGTCCAACTATTAAATGATACTTCACTTTCCTTTATATAGGGACT ACCTTTCTTTACCCACCAGTGATGATTCACAACCTAAAGCTCAGATTGAA TGAAGCTACAGATTATCCAAGTCATCCTTTGATGGTGGAAATCTATTCTG ACCTTTGCAGAAATTTCTGCATGATAACAACAGGACTTACAGCAATAAGG TAAGAACAATTAGATAATTCATGATTGTACATATAAATATTCAGCAAGTA CGTTTCCAGGAAGCAGTGTCCAGCGGGTCCACACTGATGGGGGCCATCAC TTAGATGTCCTTTTTTAACATAGTACACACAATCCCAGATTTCCTTGGTC TGCTTCAGTCTGTTACCTGGTAACTGCATTTTGGTGCTAAAGTTGATGCA GCCACTGGCTCGTTCAACTTGTCCACTGTAGTTGATGCAACCGCAGCAAA CAAGAGACAAATTGTGTACTTAGAGTCTTCTAGAGTATGATTAGACGGTT GCGTCTCATAGCAGGCTTGTTCTCGGTGAAATGTGCAAAATGCTGTTGCC ATTCTTTATGACTTGATATGAAGCAAGTTACAGGCAATGCTTTCTTCATT TCCCCACAACACCTCCATGGGTCCTTTTATGTTTTAAGAAAGATGCACCA CAGCATAAGTATTTGTTGATGGCTTGAAAGAAATTGTAGCCACTGGTGGG ATTCCCCCCTTAATAAACGGCTGTAGTCAGAGAAGACATGAAGAATAACA ATGCATCAAGGAAAAATTAAGCTGTCATTTTTGGGTGATCATTTCATGAA GACATTTTCCTAAAAAGTATGGGAGGTGTGCCTGAAAAATGAGCTCATCT GTTTTTGCGAACCAGCAGTCGCTATTTTGCACATTTCACTGAGAACGATT CAGTAATGATTCTGTGAGCCTGCAATATATGCATTCTTTTTTTGCTTTGA CTTGACACAGATATGTAGAGATAACTTCTTGGTCCCAGCTTACAGGTCGC ACCTGCTGTCATATAACATACAACAATACATGATTGTATTGATTCATGTA GTATGTTGTGAATTCATAATCATTAATCCAAGATAAGTTTATTTTTCTTC ATGTTCTATTTTATTCTTGGTTATCTTAGGACAGAGTACAGGCGAGCCTT TTCCGCCATCAATTTTGGCGATCCCAAGCAGCTTCGACTTACAATGCCAC AAGAGTTGCTGGGGCTGGACTGGGTAAGTTAACACATAAACTGTTTATAC AGTCCATTTGGCTTCCTAACTTTGAAACTTAAACAGTCAAATTGAATACA AATTGAATACAGTTTATTGATTACATTCTTTGCAACATTTTTTTAATTTT TTATAGATTGAAGTCTACAATGCTTATACTGGGCGATACTACCATTTTTC CTGTCGCAGCAATGATTGCAAGTTGTCCACTAATCCCAGTGAGCGTACCC GACAACTCACTTTGGAATTTGATGGTCAGTATATGACATGACATGATTGT GAATTTGACTTGATGTAGGGGAAATAAGAGTAAAAAAAAATGTTGGTTCA TTGTAACAAGCCTTTTATCTTCCTTAAGAATGTGTTAAAGGTAAAGTTAC ATGATGTGAATATCTTCAGATTTGACAGCTCTCACAATGCCAAAAATATG TAATCCATTGAAGATTGCTTTGTTTTAGAAAATATACAGAAACACACTTG ATTGTTAGAGATACATATATATAAGAGATTCATGACTATGTTAGCCTGTT TTTGTAGTTCTATTTAATTTTTCTAGTTTGTAGTAGACTGTACCAAAGTC ACTGTACTTTTTGTTGTGTCAATAAAGCTTCATTTCATTCATTTCATCAA CAATCAGAGTGCACTTCTTTCTTGTTTTTAGTCACTAATCTGAGCAAAGT GATTATTTCATTTCAATATGTATTATTCAACAGCCATTTCATCTGAATTG TACCTTTCATGATTCATTACCAATGGAGTGACATCAGCAGGATTCTTCAG TGGTCAAGAATGCAGGCGTCATATCTCTCATCATTGTCTTCCCCCCTTGT CTCTCTTGATCATTCATGGTCATCCAAAGTCAGGAACACAATGAAGAAAA TATCCTTTTATGTTGTGTTATGGCAATTTTTCCATTTGTGTCTCCCAGGT AGGTGGTCATATGGGATTTATTGTTACTGCCTTTATTGTTACTGACAATA GCCAAGTGTTTCCCAACTATTGAAGGATTGAAACAGCACAGTACTTCTAA TGTATGTGCCATAGCCAATTTGGGAAATGTCAGGAGTTACTATTACAATG TATTATATGTATCACATTGTTATGGTCTTGTGAACAAATCTGCTAAATAA CATCTTCAGCAAGATTTGTTACAGGTCATAGTCTAAGGTATCAAAGCAGC TGGGCATTAACTTTGCCCAGAAGGCTAATATAGTATGTTCTTGGCAGCTT TTTTGTGTATGTGGTTGAATAGCATAACTCAAGAAGCTATGGATGGATTG TCATGAATTTGGTATGTAGTCAGGACATTCAGCATGCACAGGCATATTAG ACATTGATTTTGTGTTTTTACTGTTGCAAACTATGTACTTCTGCCACCCT CCCAGAACCCTTTAACTTTAGAATTTACTATTCCACTGTGTGAGTCAGAA CTTCTGCCATTACTTCTGCCACCAGCTCTGATGCTGGAAAATGATACATG TACCTGAGAACTAAAATAAGCACAGGACCTTCGCTGTTTTCAAAGCAGTG TCACTTTTGATGGTGAACCAGGTTTTTAACTTCACATCCCAACCCATGGT GATTTGGGGGAACACAACAACACAAACCATTTGAATCAGTCAAGAGGACT TAATTGGACATCTTAGATACTGCTGTCATTAAAATGATCAATACATGTGT CAATTTGACTTTTGGGGGAATAGTAATGCAACAACAAAAAATTACCTTCT CTTTGACAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCT GTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGG AGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGG GTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAAC CAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCT AGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAG TTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAAT GTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTA CTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTA CCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGGTGA GATGGAGTACATTTAAATCAACCCCAATTTACACTTGTCAGAGATATCAT AAAACAATTTGACAAAGAAATCCAACAGAATATACCAGTCTGAGAAAAAA TGTTTTTTGTGTACTTCTTGTCCATGCCCAATTGATCTCTTGCCTTCCTT GCAGCAAATGTCCACTACGTCTTCTTTTTATGAGTCAAGTTGATTGTGAT AAATGACTTTCTTTGACAGATTAAACAATATTTCACAACTTTTGCAGCCT GACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACC ACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTT GACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGGTATGGCT ATAAATGTTCACACAAAATCCTTCCAACATACCTTCCAAACATAAACTTA TGATGCATGAAGCAGATCAGTACACATATAGATTATATTGATATGGAAAA ATACCTGTCTGGTATACCAAACCCGTCTGATCATGAAAATTACCAATAAG AGATTTGTTGCATGTTGGTCAAGTTTTTGCATTTTTGCAAGTACCTAACC TTAATGCTTCTTTTTGTGATGTTGATTTACAGATCTATGTAAAGCTTGAT GCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGC ACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTG GCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTT GATGAGGTTTGTTAATGAATGCATTCTCTACATAATCACAAAGTACAGTA CAGTCACTTTTTTGTCATCTCTTGTTTGATCTTAAAAGGTACATGATATC AATGTGGCTAGCCTTATTTTTTGTCACAATCTGATATGTTGTGCAATTGT ACAAGCCTTTGGACATTTGGACATGAACTGCAATGAACAACAAGCAGTTC TGGAGAGTAAACTTCGCTTGCTGCACCTCATAAAGATGACCAATGATGAT GATGATGACAAGCCTTTAGAAGCTGTATTTTTCCCCAATCAGATCCAGGT ACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTG TAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGC CAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGT CGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGG ATGTGGACATCTATATCCGAGGTAATTCCTGACTTGATATCAGTTATGAA GTGCTACTTGAGGTAATTGAATTTTAGTCTTATGTCACAAGCTGAAAGAA TGTGGGCTGTTTTCAAAGAACAACAATGTCATGTATGATTGTGGTGCACA GTTAATCAATTAAGATGAAATGTTGTCTCCCTATCTCAGGCAACCTATAC ATGAACTGACTGGGAACAGAGGCCTGGAATTAAAAATGTTTCCTATGAAG TCGTTATTTACTAAATGTGAACAAAATAAAATAAAGAATAAATTGCCCTC AAGTTGGGCAAGAAATTGCACTAGCTGAGAGGCTTTTGTCCAAGGTGATC TGATGTACCTGATTCAGTTTTTGATTTATTGCTGTTTGACCTAATANGAT TCAGTTTTTGATTTATTGCTGTTTGTGCTAATAGACTTTTGTCTATTTCT CCTTACAAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGA TGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCA TGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAG TAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATG GTAAGAATATAACAAACATGTTCTCAACTAAAAAGAGAAATTCAACCACT ATTCAATGAATGTTTTTTACATTCAATGAAAGCACTTTGCATTCAACAAA TGTATTCGACATTCCAATGAATGTATTCCGCATTTATATTGTGTATTGAA GTTTTCTTCATTGTTTTATTAAATTATCCATGGCTTTGTGCAACTTCCAG CATGATTGTCATAAGTACTGTCCACAGGACGTATATGTTGTACAAATGCT ATGTATAGCTCTGTTTTCTTGGCTACAAGGCAATTATGACCAACAGGATA CTACTGCAAACTATATCTTTAATAGTATGTGATCACTAAACTAATCATCA TCATCATCATCTTGCATACACCCATATAACCCTGTGAGGGCAAAGTAGGG GGGGAGGTCCCAGGCTAAGGCGGGCAGGCCTCCAGCCTGGCACGATAAGA CTCAACTGTGGGAGCCGTCACAACCGTGCCAGGCAGAGCATTCCACTGTG GAATGGTGCGCGAAAAAAATGAATGCTTGTATGAATCTGTCCTAGCATTA AGTGTTTGAAATTTGAGATGGTGACTCCCCCTAATATGTTTGATTTTGTC ATTCTCCCATCAGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATG TTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGG CAGGAGGCCTCTGGTGGTATGTTTTCTGTTTGACATATTAATTATTGTAA TTGTCACACTGACATCTATTGAATTTGATTATGTTATGCTCTGCATTATA TCATTGTCTAGTATAAAATCTAGATTTAACTATTTTCTAATGAAGGTAAT ATTATCATAATGCCAACAATTTTGAAATCTGATGTTTACTTTAATTAGAT GTACATGTAAGACCATAAGCTATACATTGAAAGTCTTCAATAAAGGTAGA TGCTGGTCCATAGTAACCATAAGAATTCCATCCTGTATCCAGATGGTACA GGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGG TGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCC TTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCAT CTTGGTGGGAGAGGTAAGTCTAATATTTCATGATATCAGATTTTGGCTTT TCTTATTAAAAGTGATATTCTTTGAGAACAATTCTTAAAGGCCATGGTAA AATCAGAGTGATCGTTGCTTCGAAAATGATCAAACTTTTCCGGATGCTTC AATCAGTTATATGCAATTCTAATCAAATGACAAAACAGAAACATAAGTTA CTTTAAATGTTTGTTTTCAAGGCTATAAATGTGTATAGTAAACATTTGCA GTATGTCTTTTGCATATATGTTAATTATTTGATATCGACAGGTGGAGGGC GAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACT GCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGG GAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATG TGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGG GGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGG TAATGTAACTGTTACTGTGTACTACACAGTCATACAACCACTTCATAGGT ATGGTTCTGTTAAAGGAACAGTAACAGTGTACTACACATACAACCATCTC ATAGGCATGGTTCTGAAAATAACAGTTACACTTTATTACACAAACGTACA ACCACCACAAAAGTTTGGTGAAGGAACAGTAGCTGTGTTCTACACATTAA CGTTGGGTAACATAAATTCGTGGGGTACTTAAATTCGGGATTTTTCGAAA AATTAGGGATATGTGCTAGATGCAACATCAGTAATACCGCTAGAAATGCA AACTTGACAGACTAACGTTTTCAGAACACTGTCTGAAAAGCTTCGATAAC CATGCATTAGAAGGCGACGAGGACAAAAACTCTCCGTCCCTTATTGGAAC AGTCTGAGGGCTTCGTGGGAGAATCACACTACATCGTTGTCGGCTGGTTT GTAAGACAAATGTCACATCCGCTTCCTGCTAAACACAATCATTTACAAGA CAACTAATTTTCTTAAAATTGCTGACCTGCAATTGGACTCTAAGTGTGAT CAATCATCAAAACCCCTCTTTGTTGCTACAACCTACGGCACGTGTATTTT CCCGCCGCCATATCATTACCCAGAATCCTGTTGTCAAGCAGACGACAAAG GTTTGTGAGGAACACTTTTTTGTCTAAATGTTGCGTGTGATTGTGGACTG AGGACGATATTTTCCTCAAAGTTTGCTCCTAACACAACAAGGAATACATG GACATAGTAGTATTATCAATGCTACGGCATCCGGCTAACTTTCCATGAAT AATGTACACGTTGCCATGACGGTGGATGTCGACTTTGACGTTCTATAGCT ACCGACTCAACACACGGGTTGTTCCCGTAGGCCTGATGTGTGCGGTACGG CCGTTTTTTCGTGTATTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTAG GTTGGATGGAGATGTACACACTGAAGTTCAAATCATGCGAAGTTATTGTG TTTGTGTGTGTGTGCGCGTGTGTGTATGTTTGTGTCACCGTGTTTGTATG TATGTGTCACCGGAAGCTTAAAATCAGCATAACTGAAGAACGTGTGGATG GATTGAAATGATATTTGGTATGTGGGTAGGTGCTGGGAGGAGAAAGGTCA AGGTCGATTTTGGGCCTCCTGGTATGTGTCACTGGAACTGCAATGGCGTG TTTGTAAATATTTTCAAAGGAGAATAACTGAAGAAAGGAGCGACAGATTT TAATGTTATTTACTATGCAGGTAGCTTAAGCAGAGATGTATACAATGAAC TGCAAATTATGCAAATTGGACTTAATTTGCATATTATTAAGTAATGAGGA AAATCTATATCTGCAGTGTTGTCATGTGGCACCCCACCTGTCAGTAGCTA TTTATAGCGAAAGTACACATAGCGAAAGTAGGTCAGACTTCTCCCCTTGC AGTGTGGGTCATACCATTGAGCGATATAGAATGGGGGGAACTGGTTTAAT AGAAAAACAACGTTTCATGGAGATTTTGGGTCCTAAGACTCTTGTTTCTT CTGTCAAACTCGAAGTGTAATGCTTGAGATGAAACGTAATATTTTTACTT GTCATATAGCTAGTTAGTAGTACTGTATTGCATACCGGTATATATATATC ATGCATGAGCAATTAATCATCAATGACAAATCATGGATCCGCAGGCCAGT TCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTG TACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCAC AAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCA CAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCT CATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAAT CGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATAC CTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTAT GGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCT CCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACA TTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGAC CTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGC AGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACA TCACAGTTGTAGATGGAGGTACAGTAGCGTGTTGCATTTTCTTCATTTAT CAATATTAAGTTTACAAATAAGTTACAAATGTGAATCTGAAATGTAGATT TTTCAAATTCTGAATATTTGTAGTTTTTGCCCACCAGATTCTACAATATG TCCCTTTAAAAAGGGTTAACTAGCTGGGTTAACTAGTGGGAACATCTTTT TGCATCAAACTTGAACTACTTATCAAAACTTTGCCATCTAGCTGATCCAA TTGCCACTTACCTTTTAACTTAGTAATACATAATTATATACATTGTGATT ATTTGTTGTTCTGCTAGGAATCATAAAAATGCATGAGATGATTGACCTTG ATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAAC CATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGG AACATTTGTACAGGTGAGTTCTTCCTCCTATCAACTCTGAGGCATTGCCA AAAATGAATTGACATGTTTAGATTGGTCATTTTACTCTTTATGAGTTTCA CCTTGTAACTGTTAGATAATGTCATAACAAACAGGTCCAATAATGGAAGA CTGTAGCACAAAATGTTTTTTACATATTCATTCTTACATGTATATTTCAA TTTTTTGAGAGAAGGTGATCTTAGAAAATAAGACTTTTAAGTTAGGAAAT ACAAAATGTGTAATGTTACTAATTATATATTTAAAAGAGGATTTCATCAA TTGTGGTTATTGACCATTATCAACCTCAGGTGCATGGAGGTGGAGTTATC ACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAA AGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGGTCTGTGCA GATTATTGTTCAAAATTTACTCGTAAAAATGTGTTGTAGAATTCTTATGG ATTAGTTGCAGACTCTTCTTGATGAGCATCTTTTTTCTATACCTTTCTGC AAGTGGTGACATTTAATTGTCAGTATTCTGGGGATTCATTGTCTACAAGT GAATATCATTTATATATGAAATGTACATTTATCACAAAGGGTCTTTGACT ACGAAATGTTTCTGTCATAGAAAGCAACAATTTTCTTTCTCCATTATTAT TTCAATGAAAAAAATGGAGATATTGTTTTGACTGTGTCTGCGTGTTTGTC TTTCCGGATTTTTGTAGTCAGCATTACTCAAGAACCTTTAGATGTATTGT TATAATGATATTTGATATGTTGGTAGATCTTGGGAAGACAAACATCCAGG TCATGTTTTGTTTAATAGCATTTGAATATCCTTCCAGTTGGTCCAGGTGC AGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTG GCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTC CTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGG CGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTG TCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGC AGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAA GATACAGGTAGAATGGAATTTTCCTTGGTATCTAATGCTTCAAAAGGAGA ACATGACAGACATGTTTTCAAATTACGCTGTCAGTATTAATCCCAGTCTG TTGTTTTCATTTAAGATAGAATTTCAAGTAAATTTCAAATGTTTGCAAAC CTCAAAAATGCAAGATTTCAATGTGAGAATTTGACTTACATGTCATTGAC TGTATCATTGTTGTCAAGATTGATTTTTTTTCCTTCCCATTTCCCCACAC CTGTACTAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAG GATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCT CAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTC AAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTA TAACCAACCAGTAAGTTGGTCATCTATTATCAGAATGGGACATCATGTTT GAAATTGATGTGTGTTCATGAACTACAAAGGGCATTTAAAAATTCTGAAA ACTATCCAATGCATTTAAGTTACATGAAAAACAAATTTATCACTGACAAT TTAACCTACTCTAACTTGTAACAACTGTGTCTCTACCTGTAGTCCCGGAG AACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATG TCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAA GGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGC AGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATA TCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCG GTATGTCCAATGTCCAATGTAATGTCCAACAAATCGTTATTTAGTGCCTG GTGTAAAGCAAGGGCTACGATGTCCACACTGTACTGTAATATATCTACAA TGTAATGATATGCATGTTTGGAACATCCTCCTTTGACTTAATATGTAGAT ATGTTGAAGAAGGTTCTTTTCATGTTTGATCCTGCAGAACGGTACAGTGG GACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGT

Coding sequence (CDS) from alignment at Sc0000048:1895029..1926373+

>transcript:BL96890_cuf5 ID=transcript:BL96890_cuf5|Name=transcript:BL96890_cuf5|organism=Branchiostoma lanceolatum|type=CDS|length=367290bp|location=Sequence derived from alignment at Sc0000048:1895029..1926373+ (Branchiostoma lanceolatum)
ATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGG
AGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGAC
GGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTAC
CAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGA
GGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATA
GGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATT
GACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGA
CTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGG
AATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACAC
CAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAA
TGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTAC
ACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTC
CCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGT
CACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATA
TACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGA
GGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAG
GGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACC
CAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATC
ATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTC
AGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTA
ACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATT
CCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGG
AGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAG
ACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATC
ATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGAT
GAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTG
GAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGG
ATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGG
CCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCC
GCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTAC
CATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGG
TGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCA
TTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCT
GACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACA
ATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGG
AGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTC
GGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGG
AACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGA
TTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTT
GCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACT
GGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGG
AACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGAC
ATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAAC
CGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTG
GTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACG
ATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTC
AGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTC
CACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTT
GGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCT
CTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAG
CAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGA
GCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGG
AAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTG
CTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCG
GGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAAC
TTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTG
AGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTG
CACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAA
GAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCA
AAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAAC
CACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGC
CATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACA
TGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATG
GATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCA
GACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTG
TCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAAT
GGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAG
GCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTA
TCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCA
GGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAA
GATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCA
GTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACAT
CGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGG
TTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCA
ACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGA
GGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGT
GGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTC
TGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGT
GCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGG
AGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACT
TCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTAT
GGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTT
TCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATG
GAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGAT
CTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGG
AGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACT
ATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTC
CATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTT
GACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCA
TCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACC
ATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCG
CCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAA
AACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCT
CTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTA
CCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTG
GGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAG
CTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGAT
CAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGC
AGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTAC
GTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCA
GACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATG
TGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTA
AACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGG
AACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAAC
TGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGG
TTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGAT
CAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTT
TCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGA
AGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAA
TGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTA
CAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAG
CATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGC
ACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAA
ATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCG
GGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGT
CTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAG
GCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACA
GTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCAC
CGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCC
TGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAG
CATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCA
ATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTG
ATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACG
AGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTAC
AGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTG
ACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAG
TTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCAC
CATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATT
TGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGT
GCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAA
AAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAG
GAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACC
ATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGA
GGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTG
GATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATA
TACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAG
TGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAG
TTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCAT
GCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAG
CATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAA
CGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGG
CGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAA
GGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTT
ACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTC
GACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCA
GATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTT
ATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACT
TCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTC
CAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCT
TTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATA
GACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGAT
CTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGC
AGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAG
ATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGA
TGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCC
CTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCA
TCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGT
TAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTG
ACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGG
TTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAA
CCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCC
GAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAG
TTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGT
GGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTA
CGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGG
TCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGC
CCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATG
GTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGG
AATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATC
CTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCC
CTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAAT
GCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTC
AGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACA
TCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATG
GGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGT
GTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGG
ATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAA
CCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGT
TACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACA
TCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCC
CTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGA
AGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTG
AGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGC
TTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATC
TCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTT
TGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGA
GGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGA
TGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAG
GAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAG
ACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGAC
ATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGC
ATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTC
ATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTC
TGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAG
GTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACA
GGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGG
AGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAG
ACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCA
GGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAG
GAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATG
GAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTT
GATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGC
ATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCC
TGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCC
CTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGG
AGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGG
TCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACA
GGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGC
AACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGG
GACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAAC
TGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGG
CTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAG
CACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCA
CATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGG
GGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCC
TCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGG
GACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGG
GAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTAC
AAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAA
GCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTC
CATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAG
CAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTC
AGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGA
AGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGA
ACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGG
ACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACA
GGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAA
TTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCAC
GGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGG
TAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACA
CCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGAT
GATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAG
AGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGT
ATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAAT
GGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGT
GACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGG
CAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTAC
TGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGG
CTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGG
CCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCA
AAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGG
AACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCG
ACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTAT
ACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGG
CCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGC
AAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTC
AATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGT
GCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACT
TGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCA
ATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCA
CGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATG
GAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTC
CTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGA
GCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGA
GGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGAT
GATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTA
CAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGG
GTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACA
CCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGG
CAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTT
GGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAAT
GGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCAT
TTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACG
GAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGC
CGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCA
GGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGC
AGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCAC
GAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGT
TGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTT
GGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGAC
TATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCT
AACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTG
GAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTG
GAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGG
ATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATA
TTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGC
GAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAA
CTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATG
CCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAG
TTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCT
GGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATG
GAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTT
GGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGG
AGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCT
TCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATC
GGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGG
AGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATG
GTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTT
ACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCC
TTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCA
ACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGA
GATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAA
GAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAG
CATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCA
CCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTC
TGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACC
CCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACT
GATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTT
TGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACT
GCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACA
ACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGG
CTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGT
ATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCG
GAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTA
TAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCA
ACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCG
GTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCG
CCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACT
TTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTAT
GAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGT
GCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTG
ATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACT
CCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTT
CCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCA
ATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAAT
GTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCT
TGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAA
CCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGA
GGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGG
GCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAG
GATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGC
AATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAA
AATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAG
AAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGA
AGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGC
CAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGAC
GTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACA
GCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTA
TATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGA
TCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGT
GACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGG
TGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGC
TGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACA
GATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGT
GATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCT
ATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCT
CAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGC
CAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGT
CCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAAC
ATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGA
CAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCT
ACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGAT
GTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGG
CCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCG
GTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCG
GGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGG
AGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGC
ACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAAC
GGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCT
TCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTG
GTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATT
GCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACA
CGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTG
AGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAAC
AACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTC
TCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTG
GAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCT
AATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTC
TTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCAT
TTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGC
CTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAA
CCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGG
TTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTAT
GTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCAT
TCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTA
CCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATAC
CATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTT
TGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACA
CCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCT
AGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCAC
ACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCC
ACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTA
CTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAA
AACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTT
TGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAAT
GACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCT
AACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAG
GAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGT
GGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCT
TATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATC
TTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTC
GTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGC
AGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTG
ATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAG
GAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTA
CACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCT
CTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGAC
AACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCA
TGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACA
ACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTAC
ACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTT
GTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATG
TCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTA
TGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCA
TGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATG
CTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTG
GCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCA
GGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCA
TAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTC
AACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAA
TGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAG
GTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATT
GTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGG
AGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGA
GCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCC
GCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAA
CAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTG
TTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAA
TATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACT
GGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTG
GAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGA
AGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGG
GACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGA
TATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCC
GAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTA
TGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCG
ACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACC
GTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACA
CAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTC
CCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCAC
CTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAG
TCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGT
ACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGG
GGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCC
GGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCG
TTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAAT
CTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACA
CTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAG
ATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTG
TACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTT
CTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAG
GGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTC
CACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCA
TGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCA
CAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTA
CTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGA
CGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTT
TTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACT
CGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGAT
TGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACG
GACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTC
ACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGAC
TCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAAC
CATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAG
CGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGG
GACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATG
GAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAAC
ATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAA
CCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCT
ACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGT
GGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGC
TTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAATG
GAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGAC
GTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACA
CTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCT
ACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCA
AGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCT
TGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGT
TCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACA
ATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGA
AGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGA
GGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTC
CAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGG
AATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCC
ACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGC
GGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAG
GACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCT
CTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTG
ACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGC
AGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCA
ACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAG
GATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGAT
GAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGG
CCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATT
GCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATT
TGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAG
AACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACAT
CGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCC
TATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCC
TTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCAT
TTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGA
CCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACA
GGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGG
CATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCT
AGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGG
GGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTG
AGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCG
CTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCA
GCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATT
GTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGA
GGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGAT
ATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAAC
AGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTA
CAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACC
CAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGG
GGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACAT
CACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCA
GTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGT
GGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAA
TGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACA
TCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTT
GGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAA
GGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCA
CAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAG
ACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCAC
GTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCG
ACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAA
ACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCT
CAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCAT
GTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCT
GTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATA
TGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCA
CGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTT
GAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGA
ACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGT
ACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATG
CCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACA
TGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCG
TTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAG
GGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAG
ATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTG
GGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGA
CATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAAT
GTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAA
CGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACA
GCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCA
TGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAG
AAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGC
CATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGC
CTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATG
GCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCT
GTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAAC
CACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCA
TTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATC
TGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGG
TGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGG
CCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTAT
GGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGA
ACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACA
ACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTT
CGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCAT
CACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACA
TCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTG
GTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCA
TGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTAC
CAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGT
CTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACAT
TGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATG
GCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGT
GTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAG
AATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGA
GGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCA
GGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGG
AGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTG
GCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTT
GCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCA
CGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAG
ATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAG
TCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCAC
CGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTG
CACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTT
TACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGG
TCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTA
TCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAA
GGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGC
CGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTA
CTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTC
TATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTA
CAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCT
TGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACA
ACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACAC
AGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACC
AGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAG
CTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCT
GTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAG
CACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTT
GAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGG
AGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCC
TGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGAC
ATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCC
GCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTG
ACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGAT
CACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTT
TGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTG
GACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTT
GAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGT
GGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTG
GCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAG
GGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCC
AAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTG
GGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTG
GACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGG
AGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAG
ACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCC
ACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACA
CAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAAC
CAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAG
ACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTC
CAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAG
GGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGT
TATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGA
GATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCA
TTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCG
GTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGA
CCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCA
ATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACC
ACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGT
GGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAA
TGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTC
AATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACA
GAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAG
TTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGAT
GTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGG
TCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATG
GTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTAC
GGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGG
AGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTA
TTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGA
GGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGG
GACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTG
GCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTG
GAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGT
CTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACA
ATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGAC
CAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACA
TGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCA
GGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCAT
GTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGAT
TCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACA
ACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATC
AAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAA
TAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCA
GGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCT
TGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAAC
CATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAA
ATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGAC
AAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTT
TGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAG
GCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGAT
GAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCA
ATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAG
AGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTC
TACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGT
GGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCC
ACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAG
GACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAG
GCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAA
CTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTC
ACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGC
AGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACC
TGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGG
CTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAA
TGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACG
TCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCC
TATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAAT
TGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATG
GAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATC
AAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTC
ATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCA
TCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGG
GCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTAT
CTACCACATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGT
TAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACA
ACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTT
TGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCT
CTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTG
TTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCAT
GAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCA
CACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATC
CACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCT
TACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAG
AGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGAC
AATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCAC
TTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCA
CACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTT
CTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGC
AGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAG
GTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGG
ACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGG
CGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCA
CGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCC
CACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTC
CTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGT
ACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTG
TACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGG
TTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCG
GTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACA
CTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGC
CAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCC
AGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAG
GAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGT
GGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTG
GAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTC
ATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACT
TGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCA
TGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTT
TTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAA
CGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCT
TTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAG
GGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGAT
GGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGT
CTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGT
GGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGAC
TTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTG
AGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATC
CTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGC
AAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAG
GCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACAT
ACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGG
AAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGC
ACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCT
TTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTC
AGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATC
ACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATG
AGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAAC
CTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGT
ACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAG
TATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAA
TGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGA
GTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACC
AGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAA
CCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGA
CATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATC
TATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGA
CAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACAT
TTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGG
AACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGA
CAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATG
TGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAA
CTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTC
TGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGG
TGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATC
AGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTC
ATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTAT
ATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAA
CATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGG
CTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGAC
CTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGT
GGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGG
ATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCG
ACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTG
CGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAG
ACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATG
GTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTA
GAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAAC
TGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCT
ACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGG
AACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCA
GAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATG
GCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGAC
CTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTG
GCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACG
GCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAA
GTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGG
GAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGA
ACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGC
ATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGA
CTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACA
CCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGG
GCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGA
CGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAA
ATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGAT
TTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGG
GAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATG
GAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTAT
GACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGG
CAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCA
TGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGG
ACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGG
ACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAG
GCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTAC
AGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGA
CAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACC
ACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCA
TCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACC
TACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCC
AAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGG
CACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAG
CACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACA
TCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCC
TTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGG
TTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATG
CTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGAT
GCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGC
ACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTG
GCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTT
GATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGG
CAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGA
CCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTG
CCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACG
TACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCA
TACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTG
GATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGA
AATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGA
CATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTG
CACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGA
AGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTC
CGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTAT
TCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACAC
GTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAG
GTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGC
TTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGG
AAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAG
TGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCA
GGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCA
CTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTG
GTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAA
CTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGT
CACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGA
GACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCT
TCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGC
TGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATG
AGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGC
CCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCAC
TGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTC
ATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCAT
GGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGC
CAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATG
AGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCC
ATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCA
ACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCA
CATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAA
GGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGG
TGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGA
GTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCC
TTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGC
TGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAG
GTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGA
GGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGG
GAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAA
GGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCC
TCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTT
CAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCT
ATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCT
GATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGG
CCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGT
TACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGAC
CGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTT
CAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCT
ACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGC
TCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTA
TCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATA
ACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGT
GATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTT
CTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTG
GACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGAT
GGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAG
CTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCC
ACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAAT
GTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACAT
GATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGG
AACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTAT
GGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGAT
TCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATG
GAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTC
AGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAA
TGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGG
CCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATA
CTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGG
ATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCC
TCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGG
TCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGG
TCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCG
GCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGT
GGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATAT
TGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTG
GAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGA
TATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTC
ACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACA
ACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGG
GACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCA
CATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAAC
CCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGAC
GGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAA
TGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCC
ATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTC
CTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCA
AGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTG
TTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAAT
GTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACT
GCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCA
TGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGC
ACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTA
CACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCC
TCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGAT
GCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGAT
CAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCC
ATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCA
TATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGA
GAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTG
TGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAA
CGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACAT
CTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACG
ACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTT
CGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGC
AGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGAC
CAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTG
ATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTA
TTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTG
GTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTA
CAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAG
AGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCA
TCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGAC
ACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCC
TGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACC
ATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTG
ACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCAC
TGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTC
ATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGT
GGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGT
AGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAAC
TTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGT
CATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAG
ACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCG
GCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGAT
ATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAG
CAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTG
GTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGA
CACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGG
TGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCAT
TTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCC
GAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAA
CACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGA
TCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGA
GTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAA
TTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGC
TGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTC
CTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTA
CTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAAT
TCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGAC
TATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACC
TGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGG
CCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTC
AATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGC
AAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACC
AGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGA
CTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGAC
TGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAG
ATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAG
TACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAA
GATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACG
TCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTG
TCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGA
CAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAG
GCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTT
GTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTT
CACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTC
AGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGT
GGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCAT
CTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATG
GACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGA
GGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTG
CCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTC
ATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGT
GAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCA
TGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCC
AGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGC
AACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGC
CTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCC
CTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTA
GATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTA
CCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATG
CCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAG
GGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAA
CCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTC
AGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGG
GAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAAC
TATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGG
GAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGAT
GGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCAC
TGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATC
TCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCAT
GCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATA
TGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCC
GCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCC
ATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGG
TGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACA
CTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGG
TCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCT
GGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTG
GATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAAC
AACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGC
TGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATA
ACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCA
GAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTT
AACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAA
CAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCC
TTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTAC
AGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACC
ATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAA
GTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACAT
TGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTG
TACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGT
GGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGA
GAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCG
CCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAG
ATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAG
GTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGC
GGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTC
TCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGA
GTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAA
ATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCT
ACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGA
GGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTT
CCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTAC
ATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGT
ATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAG
GTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAG
TCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGG
CAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAG
GGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTA
ACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGG
AGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGG
ATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGA
GGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCAT
AGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCG
GCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTG
GATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCA
ACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCAC
GAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACA
TCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAG
AAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTC
ACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGG
GAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAA
AATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCC
CCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAA
CTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTG
TGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGA
TTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAA
ATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGT
CATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGA
CCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCC
ATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGG
CCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCG
GAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTC
CTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGG
GGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCC
TAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGT
GGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGAT
ACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGG
CTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGA
GGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGA
ACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACC
AACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGAT
CACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCT
GTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATG
TCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGA
GAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGT
CAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGC
AGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGT
GTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGC
CGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCA
CCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGAC
ACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTA
TCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATG
AACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGC
CGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGG
ACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTG
CAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTC
ACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGG
AGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCC
ATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGG
TATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCT
GGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCT
TCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCAC
TACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTAC
CACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCT
TTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCT
GAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGG
GTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATG
GAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGA
GCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGG
AGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTG
CTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACT
GGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGG
AGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTG
GAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGT
CGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGG
AGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAA
CAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAA
ACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGT
GTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGG
ACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGC
CGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTAC
CCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTG
CTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTAC
ATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGAT
GGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACA
GTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGC
ATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCA
CAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAG
CAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATC
AATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAA
CGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGA
TATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGAT
GGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATAT
TGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGG
GTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGG
CACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGC
AGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCC
AGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCAT
GGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTG
CGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGG
GGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAG
AATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTA
CAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGA
CAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGAC
AACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGA
CCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGC
ACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATA
TATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGC
AACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACG
TTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCC
TTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACAC
TGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTC
ATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGT
TCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTAC
AGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTG
AGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACT
GTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGA
TGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTC
CAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGT
GGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAG
GAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTG
GTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAA
GTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGA
CTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCA
GCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATT
CAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGG
TGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACG
CAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCT
GGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAAC
TCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTA
ACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCA
AGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTA
CCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCAT
ACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCA
GATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGT
CAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGG
TTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTA
CTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAG
ACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCC
ATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGC
CAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGAC
ATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTAC
ATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACC
ACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTG
GCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTG
ATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCC
AGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCG
AGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATA
CTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCC
CTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCA
CATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTC
ATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCC
ATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAA
GGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTT
ATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGT
CGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCA
ACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAAT
TGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTT
GGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCAT
CGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACA
GCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAA
CTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTC
TGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAAC
TACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTAT
GAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCA
AGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACC
CCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGG
TCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAA
CTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATG
TGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGC
AGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGAC
TTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCT
ACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTT
TGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGA
GTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAAC
CCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAA
ATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAAC
ATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAAC
TCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGAT
ATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAG
TTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTT
CCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTAT
TCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGC
AGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCC
GGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGA
GGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGG
GACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATG
GTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTAC
ACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACA
TGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTA
CCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCT
CGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGG
ACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTC
CTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCT
AGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAA
CCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCA
GGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAG
AGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAAC
TCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGT
TGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCA
TCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCC
AAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGG
TTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAG
GTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTC
TGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAG
GCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTG
GTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAA
GGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGA
CAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACA
ACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGT
GACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTC
GCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAAT
GTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAG
GCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCT
CCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATG
GTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGA
TGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAA
TTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCC
AAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAG
TATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGT
CAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGG
GCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCA
GTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCG
TGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCC
ACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACT
CACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATC
CTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACA
ATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACAT
ACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCT
ATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACAT
CTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCA
CATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGG
ACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGG
GCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAA
CATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACC
TTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGT
AACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAA
GGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACT
TGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAAT
GTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTAC
ACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAG
CATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCC
CAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAG
TCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTG
CAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGA
AGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGT
GAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTAT
ACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAG
GGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCA
TTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCAT
CCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATC
CTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGT
GGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAG
ACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCC
ATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGT
CTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACA
CCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATA
GCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGG
AGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAA
CAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCT
GACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCT
GCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTA
GAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGA
TGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGA
CTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCC
TGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCC
ACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCG
GACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTC
CTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTA
GGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGG
TGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGT
GGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGC
TTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGA
TCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGG
AAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAAC
ATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCA
CCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGG
TAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGA
CATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGG
GTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAG
GACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGG
GGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGT
TACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTG
GAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATT
GCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGG
AGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAA
CAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTG
GCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACAC
ACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGT
TCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACC
TGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGA
CTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTC
TTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATT
GGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCT
CCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTG
CTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGG
TTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGG
CCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTT
ACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCC
ATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAAC
CGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATG
CAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACT
GGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCAT
TGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTA
GCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTC
TATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGG
ACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCG
ACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGC
GGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCG
TGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGG
GTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATA
ACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGG
CAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTAT
TTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAAC
AACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTC
TCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCT
TTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGC
AATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCT
CCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGAC
CAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAAC
TCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCT
GAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACT
TAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACA
AATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAA
GGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGT
ACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTAC
AGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGG
ACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCC
CAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATC
GGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAA
CCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAG
CAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAG
AGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTC
TTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTC
TCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCC
CTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACG
CATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGA
CCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCC
TCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACG
TGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTG
GGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTAC
ACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTG
TTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTT
TTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGC
AGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACAC
CATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAA
CAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCC
AGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGA
GGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCA
GCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAAC
TTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGAT
TGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGC
TTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCA
GTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACA
TGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGC
CAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGA
GCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCAT
AGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATG
GCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACAT
GTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGG
CATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTG
TGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTAC
TCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGAC
CAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAA
ACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGT
AAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGT
AGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATT
ATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGG
CGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGG
GAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAG
CAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGAT
GGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGG
AGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAA
AGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTG
GGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGC
CCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACG
CAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATAT
GAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACA
CAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCA
TCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTG
CTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGG
ATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGT
ATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATG
GAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGG
TGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTG
GTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAG
ATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACT
TGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAG
CTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCA
GGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGG
GGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCT
CCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCA
CGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGG
ACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGG
AAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGA
GGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGG
CTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTG
CTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTAT
GATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGG
CGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATC
GCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTC
CAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACAT
AGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCAT
ACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATT
CAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCAC
CATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATAT
TCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAA
TACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGG
ATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCA
GGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGT
GATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACAT
TGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTG
CAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGT
GGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGA
CAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGA
TGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTG
CATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGT
GGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTG
GATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAG
CTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCG
GAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTG
GAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACA
GTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGA
GGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGG
CAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGC
ATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGG
GCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGG
TGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGC
GGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTG
GATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAG
GAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGG
GGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCT
TGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACC
TCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGT
GAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAA
CCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATA
GAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCA
TGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTAC
CCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTG
GAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAG
ATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGG
CTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAA
CCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCA
GGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCAC
AGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATG
GACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCAT
GGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAAC
ATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATC
TACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGAC
GGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGC
CAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTG
CCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAG
TTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTT
CGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTG
GACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTT
CAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGG
AGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTG
AATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAG
GCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGT
GGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGA
GAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGAT
GTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGA
AGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGG
CAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAAT
ATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGC
GAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACAC
TTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACC
AATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGC
TGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCT
TCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCA
GAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCA
TGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAA
AGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATC
CTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCA
CTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCAC
CAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATG
CCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGG
TGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAA
TAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTA
GCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCT
TGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCC
AACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAG
TTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTAT
CGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGG
GTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACC
GTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGT
ACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACC
TTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGA
GGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGC
CTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATG
GACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTG
ATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGC
AAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCA
GCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCC
AATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGG
TGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGAT
TCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAA
AATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCG
AACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACA
TCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATC
TTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCA
CTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCC
ACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGAT
CGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCG
ACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATC
TTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACAT
GGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCAT
GTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACA
ACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACA
TCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCAT
TGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAA
ACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTT
GCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCA
GACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCC
GTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAA
CCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGG
CGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTG
AGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGC
AGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAA
TATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCG
GAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTAC
ATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCT
TACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGT
ACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTG
AGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGA
TTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTG
CAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCA
CACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTT
TCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACC
AAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTT
GTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTC
TGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTC
TAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAG
ATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAG
GTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACT
TGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAG
AACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGT
GGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAA
CCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGA
CGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACC
GTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAG
ACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATG
CTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTC
CTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCA
CTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGT
GGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGC
AGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCG
ATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGA
ACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGA
CAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAAC
GTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCA
CGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTA
TCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATC
AAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCT
GCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCG
TGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGA
ACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGT
ACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCA
AACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATC
TTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACAT
GACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCC
AGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAG
ATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAAC
ATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGG
GTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTA
ACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTC
TTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGA
CCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCA
TCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAA
GATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGA
CATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAA
ATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGT
GGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGG
ATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTG
CAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGT
CAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTA
CGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAG
ACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGT
GGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGAT
CACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTG
GTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTAC
GGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGG
AGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTA
ACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGT
TCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCA
TAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAA
CATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAAC
ATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTA
TGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGA
GCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGA
GACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGA
TGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCC
ATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTC
AATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGA
ACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGT
ATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTC
TCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGT
TAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGA
ATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCAC
TCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATC
ACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATC
GTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTC
CCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGG
AGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGC
GTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCA
GGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGT
GGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGAT
CGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGG
GAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGG
CACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACAC
TGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAA
GTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATT
TGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATA
CTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCC
CCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCAC
ACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAA
TGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAA
GGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGG
GACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATG
TTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCC
ACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTC
ACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAG
AAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGT
GGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGT
GACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCC
ATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGC
GGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACAT
CTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAG
GATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGAT
CATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGA
AGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGA
TGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAA
TCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTC
TGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGC
ATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACA
CATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAA
GGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACA
TCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAG
TGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGA
GACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATG
GGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGA
ACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTAC
CGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATC
GTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAA
GCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAAC
ACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACT
TGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATC
CTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTA
CTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCAC
ATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGA
CTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAA
CCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCT
ATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTC
ACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGT
AGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATC
CAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACC
TTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGT
ACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTG
CTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGT
GGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCG
TGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCC
AGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGC
AGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAA
CGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGG
ACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTC
ACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAG
TGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGA
TGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAG
CATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAA
AACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTT
GGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTG
GACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGG
TCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCG
ATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGC
TTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGG
TACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCC
TGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGT
GGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGG
ACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTT
ACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGT
GAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACA
TAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCA
TTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCC
GACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGA
GGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACAC
ACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATAC
AATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGT
ACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACC
TCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCT
GTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCA
TATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACG
GAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTG
AGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGA
CCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTA
TCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGAC
TCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAG
TAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGA
TTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGT
GGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGG
AGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGA
TCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGG
ATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGG
TGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCT
GGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGA
GGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGG
CCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACT
ACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGT
GGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACT
CATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTC
CTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCA
CAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGA
GGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGG
TCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCT
GGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGA
GATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCC
TTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTA
CTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCT
GGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTG
ACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACA
ACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGG
TGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAA
CGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTAC
TCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAG
TCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTG
TTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTC
CTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGG
AGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCA
GAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGA
GGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCAC
TGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGT
CGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGA
ACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGC
TGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACC
TGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGC
AAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTT
CAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGA
ACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTA
GCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCA
CATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCA
TGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTAC
CAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATT
TGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCA
ATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCT
AGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGC
TATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTG
CAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATG
AAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGC
CAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAAC
ATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGA
GGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGG
CAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAG
GAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAA
GTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAG
TCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTG
GTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCA
GGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTA
CTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCT
ATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTT
TTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAA
TGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGG
ATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGT
GGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCA
CTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTT
TCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTG
TTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTT
CATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACA
CCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGT
CGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGT
AAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTT
CTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGG
TACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTC
TGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAG
AGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAG
ATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGA
GCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTT
ACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTAC
CAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTA
TGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTG
TAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGT
GGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCA
ACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATC
GGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGG
ATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGG
TTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAG
GAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCC
AATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAG
TACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATG
AGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGG
GCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGC
AAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCT
CGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCT
GTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGC
AGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCA
CAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGC
ACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAG
CCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACC
AGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGC
CAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTT
TGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACA
CGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGT
ACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGT
TGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTG
AGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGC
ACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCA
TTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGT
GTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTG
AAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGC
AGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAA
CCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCA
GAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCG
TGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGA
TATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGC
AGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGG
AGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCC
ATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGG
AGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGT
AACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTG
GGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTAC
AAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGT
TTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAG
TCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAG
CAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTC
TTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTA
CTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCC
TCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCAC
CTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCA
TAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAG
ATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACA
GCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAA
AGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATG
GATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCT
CCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAAT
CATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGA
GTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGG
TGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACA
GGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCA
AACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATAT
CCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCA
AGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTG
GTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAAC
TACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGC
GGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCT
GCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGA
TGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTG
GGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGA
TCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTT
CCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCA
ATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGC
TCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCA
CATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACA
TGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCA
GTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGG
GGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGC
AACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAA
GTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTA
CATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCT
CCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCA
GAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCT
TGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTG
GCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGA
TCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGAC
TTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTG
GAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTA
GATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGG
AGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTG
AGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAG
ACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGT
GCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAG
TCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACAT
TCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAAC
AGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGA
CAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGA
GGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCAC
AGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGC
CAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCA
AGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTA
TGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACT
TTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGT
GCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTAC
CCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTC
CCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATC
GGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCC
GGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACA
CAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAAT
GCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGT
GGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGA
ACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCT
GGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGAT
AGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGT
CACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGT
GGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGAC
CCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACT
GGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCG
GGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATT
ACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAAC
AAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTC
TCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACAT
AGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCT
TCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACA
GAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACA
GAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAA
GGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTA
CAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGG
AATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGC
ACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGC
GGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGA
CACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTG
ATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGG
AGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTT
GTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCA
ATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAAT
GTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGA
GGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGT
ACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGA
GGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGT
GGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATG
CAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCT
GGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTAT
CGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACT
ATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCA
GGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTT
GCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCC
TCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACA
GTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGA
CTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCAC
CAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGAC
CACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACA
TGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTG
TCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAG
GAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGG
GAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAG
ATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGAT
TACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACA
GGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCA
CACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTC
GGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAAT
TTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTA
ATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGC
ATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAA
CGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTG
GCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTAT
CAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCA
GCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACC
ACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAAT
GTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGC
TTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACG
ACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATT
CTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGAT
TGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATC
TGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACA
GGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCA
TATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAG
GCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTC
AACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAA
TGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGA
AGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATC
CTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGA
TGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTC
TTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGT
GGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCT
CTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCA
TCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGAT
GGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAA
TGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCAC
TTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGAC
CCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTC
CAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTG
GAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTG
AAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAG
AGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGT
CACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTG
TCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAA
CCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATA
CTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACT
TTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAA
CTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAA
CAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAG
GGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACT
GTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGT
CGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGC
TATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGAC
CAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGG
CGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAAC
CGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGA
CTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCT
ATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACT
GTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTT
TGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACA
CTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACG
TTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGAC
CAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTA
ATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAAC
CTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGA
AACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTG
GAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTT
GGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGG
AGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATG
GCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTG
AAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGG
AGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTG
GAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCT
GCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGG
ACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCA
CAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTC
TATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAA
GATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATG
GTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCA
GGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGA
GCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTA
CAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGT
GTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACAT
CTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTAT
CTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATT
GCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTG
GTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCA
ACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAAC
GACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGG
CTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTG
ATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAA
GGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATC
CGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACT
CGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGG
GGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGT
GCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCA
ACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATC
CTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGG
TGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCA
TTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTA
CACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACAT
TGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACA
ACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATC
TCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAG
TGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTC
CTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGC
TCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCC
ATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACA
GCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTAT
AACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGA
GGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCT
ATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCC
ATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTT
TACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCAT
ACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGC
TTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTA
CACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTT
CTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTC
ACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGG
CCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTG
TACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTC
AAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGAC
TTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAA
ATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCAT
CTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTAC
AGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATG
GTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTC
CTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCA
TCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCC
TCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTG
GCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTT
TGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCC
AGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTAC
TACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGG
CTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTG
ACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACC
CATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAA
CAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCT
ACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGAC
TTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGA
TGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTT
TATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTG
CATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTA
TGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCC
TGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTG
CAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAAT
CATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTT
TCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCA
AATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGG
AGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCA
TTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCT
GGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGG
GAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGAC
CCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGG
AACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTT
TGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTG
AATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAA
CTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGG
TGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATG
GAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCC
GGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAG
GATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCC
CCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGG
TATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAG
CGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGA
CCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACA
CACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACT
TCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTC
ACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCA
AGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACT
GTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATG
GGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGG
CCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCAT
CGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACA
ATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGA
CACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAAT
AGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCT
TGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATG
TTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAAC
AGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTG
TCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTC
CATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCT
CACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACAC
TACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGAT
GACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTAC
TTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTA
CTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGG
ATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCA
CGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATG
TCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGG
ACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGA
ACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCA
AGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACA
GGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGA
TGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTA
ACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCG
AACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCAT
CTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGG
GTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACA
GCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAA
TGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTG
ACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAA
CACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAAT
CTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATG
CAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCAT
CTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCC
GTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCA
CAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTG
GAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGG
GAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTG
TCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCA
GGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTT
CCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATG
GCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAAC
AGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTC
CTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTG
TGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGT
GCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTT
CAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTG
AGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGG
ATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGG
GGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAA
TTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCA
TTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGG
AGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAAC
ATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGC
CCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGAT
CCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATC
ATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACT
GACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGA
CAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAAC
GGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATAT
CTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGA
GGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGC
TGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTAC
CGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAG
CAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGA
TTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCA
GAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGG
ATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCA
ACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGG
TACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTA
CCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTG
GGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGAC
ATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGC
CAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAG
GTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCC
AATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAA
CATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATG
TTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGC
AAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATC
CACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAG
AGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTC
ACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCC
CGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATC
AAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGAC
CTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGC
ATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTG
CTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCA
TATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGT
CACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAG
TTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGA
GAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCA
GTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGA
TGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTA
CATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGC
CGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGA
AGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTT
AGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGG
TGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTG
GACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAA
ATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCT
AACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGA
CAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGAC
CATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTC
AGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTG
GCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTT
GCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATA
TGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATG
CTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATA
ACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAG
CATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCA
TCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAAC
GGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGT
GGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTT
ATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATT
GAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAA
CAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACC
TTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGC
ATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCA
CATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATG
TGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATG
CATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCT
ACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGC
GTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAAC
ATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTA
TGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAA
GTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGC
AGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGT
GAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAG
CAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCA
GGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGG
TGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGT
TTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGG
CACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTT
AGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAG
AGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTC
ACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTC
TGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTG
TTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGA
GGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGG
TATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACC
AAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTA
GCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGT
TACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATG
TCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTAC
TACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTAC
CTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGA
CAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCAC
ACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGA
CCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAA
AGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAG
CTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTC
AGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATT
TTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAA
GGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGG
CCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAG
ACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTT
CCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTT
TGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTG
ATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACC
TTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGAC
TGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACC
TTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACT
GTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGT
TGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTC
AGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATC
CCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGG
TGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTG
TGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCA
GGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGG
AGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGT
CCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACA
CACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGA
ACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACC
AGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGAT
TCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACAACTT
AGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCA
GTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCA
GAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCAT
CATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGC
CGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGG
GACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGC
CAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGA
CCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGA
GTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAA
AATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACT
TCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGA
CAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGG
AGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGG
ATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTT
GGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCA
TGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCT
ACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGT
GGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCG
TATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATG
GAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAA
GGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGG
TGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCC
TGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACA
GTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATA
CAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAG
ACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCA
CATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAG
CAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCC
ATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAG
ATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCA
CAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCA
TCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCAC
AATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTT
CAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGG
CTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGA
ACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGA
AAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTG
ACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTAC
TTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGA
AGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACG
ATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTT
CAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCA
AGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACG
TCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGA
GTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAAT
CCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGG
AGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGA
AGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTAT
AACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGAC
TCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCG
GCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACA
CCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTG
GGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTC
AATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATA
CGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGG
CCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACA
ATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAA
TGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCA
TCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCAC
TCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTT
CATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGA
GGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTT
ATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAATGGAGG
GTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGA
CAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTT
TTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGG
CTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTC
TGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGC
ATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAG
CACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGA
TCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGAT
CTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGAC
AGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAG
ACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATC
ACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGG
CACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGAC
TTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACT
GCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGG
AGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTG
GGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGT
GGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGT
CACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATG
CCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAAC
TCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCA
GTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTG
TGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGG
GGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACC
CGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCA
CACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATC
GCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCC
CCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCG
AGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCT
GTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGAC
TGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATT
TCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGA
CTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGAC
CATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGT
TTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTC
AACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCC
CTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGG
AGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAG
ATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCT
GTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTG
GTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAG
ACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGC
TGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCA
TCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACA
GCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGG
AGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGAC
ATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGT
GGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCAC
GCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAG
CTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAG
TCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAA
TCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAA
TGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCA
ACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTG
GTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACAC
AGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAAC
AATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCG
GAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGA
CCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTA
AACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGG
GACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAA
TCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTG
GACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACAC
ATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAG
GGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGA
GACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGA
TGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAG
AACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCT
TCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTC
GGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATA
TCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTC
TCATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGT
ATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAG
AACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGA
GGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGG
ACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATG
GTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTAT
GGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAG
CGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTG
TGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACC
AGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGA
TGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGC
TAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGA
ACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCAT
CTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAG
GGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACAC
CAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAA
TGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTG
ACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACC
TGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCA
CGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGG
AAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTT
GGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGT
GAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCA
GCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGAT
GACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAA
CACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTC
GGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATA
GACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGAC
AAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTG
ATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCA
GGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCA
TGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCT
ATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGG
GGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGT
CATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTG
GGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTG
GGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACC
AGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACT
ACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAG
GACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAA
CCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGT
CATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGA
CCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGT
CCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATT
GGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGA
AGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTA
CATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAG
CCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGAC
GGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTA
TGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTG
ATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTT
GCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACC
TGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAAT
TTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAA
GGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGT
GACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCC
TGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCA
CGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACAC
CATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACC
TGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGA
GAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACA
GACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAAC
TGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGAT
GAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAG
TCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTT
ATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAAC
ACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAG
AGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACG
GCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGT
GGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGG
AGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTG
CAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAAC
CACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGG
TGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACAC
AACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAAC
GTCACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAA
GAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATG
CTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATA
GCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGA
TGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCG
GCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGC
ACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGC
TCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGC
ATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTG
GCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCA
TGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATG
CCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAAC
CAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTAT
CACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCA
AAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCA
GGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGG
GAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCT
CCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGT
GCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGA
AGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAG
GAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACT
GGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGG
AAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAAT
CCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTC
TTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGG
CTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAG
CTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTC
GGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGAC
GTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTG
ACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCC
TTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACAC
CTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGG
GCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGC
TATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGA
TAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTG
GTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATT
TTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGG
TGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGG
ATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCC
AGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGC
CCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGA
ATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATAC
ATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGT
GGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACT
ATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAG
ATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCA
TGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACT
TCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTA
AATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCA
GGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGA
TACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGAT
GGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTC
CCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAG
GGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGAT
GGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTT
CGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATG
GTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGAT
ATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGG
TGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAG
GATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCC
TCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAA
CAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAG
GGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTAC
CACATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGA
ACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCG
ACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCC
AATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGC
CCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCT
TCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAAT
CAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACG
TGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACA
ATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACA
CTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGG
CATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATG
GCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTT
TACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACG
CCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAG
ATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAG
ATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTG
CCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTC
CATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGT
GAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGG
TGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACG
AACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTAC
ATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCA
CGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACT
TTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTAT
GCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGG
ACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGC
TGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAAC
TATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGC
TGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGC
TACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGAC
AGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAG
CATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTG
ACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCC
CCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGA
CCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCC
TGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGC
ACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGC
TCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAG
GTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAA
GTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGA
ACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTA
GTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGT
AGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTT
CGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTG
ATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAAC
AGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAG
TGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTG
GACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGT
GGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGC
ATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAG
CCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGG
AACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAA
GATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCA
GAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCT
AATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTG
GCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATT
TCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTC
TACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAA
ATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTG
ACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTA
CCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATC
GGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATG
TCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGT
GCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGA
CCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACG
GACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAG
ACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGAC
AGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGG
AGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGC
AAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTA
CGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCC
TGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATAT
GACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGG
AGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATC
TTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTT
TTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGG
TCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCA
GTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCC
ATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTA
TGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGA
GAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACAC
TGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGT
TCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGT
GTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGT
CATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTC
CCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACA
GCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAAT
GCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCAT
CCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGT
TAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTT
TACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAA
TGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGC
AGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAG
AACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACAC
TCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGC
GGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTA
ACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAG
GGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTG
ATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTC
ACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGA
TCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCC
ATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGA
TATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGG
CCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACT
CCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGC
GGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGA
CACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCA
GGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACAC
CTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCC
TGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGA
ACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAA
GCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAA
TAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCC
CAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACG
TTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAAC
AACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACT
CCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACT
ACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGA
CCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCA
AAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTAC
ATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGT
TGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCC
GTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGA
GAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAG
CGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATG
AGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGC
AGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCAT
GCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCAT
TCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACA
GAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACA
AAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATC
CTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATG
GAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATT
TTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACT
ACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGT
GTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTC
AGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCC
AGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTT
GGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGG
AGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTC
TAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGT
GGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGT
GGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAG
GAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTC
ATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCC
CGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTC
TGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACC
CAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACC
ACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCA
CATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGAT
AGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCT
TCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAA
GGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGG
AAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCT
CCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAG
AACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAAC
TGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGAT
GATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCA
AAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGT
GTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATC
GACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGAT
CCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCA
GGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGG
CGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCC
TCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGC
GGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGT
CCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCA
GTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAG
ATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGAT
GGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAG
GAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAA
GAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAA
CCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATG
ATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTG
CTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACA
TGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTG
GAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAAC
GTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCT
GCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAG
GTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCA
GCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGC
CACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATG
ACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTG
TATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACA
TGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCT
GCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTAT
GGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCT
TGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCT
TCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATT
GGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACT
CCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAG
GGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCAT
CTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGG
CTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCC
ACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCT
ACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTT
CTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCG
CTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTA
GGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCA
TGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAG
GAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCAT
GGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAG
TGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAA
CTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGAT
GGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGG
TGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATG
GTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCC
GGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCA
AACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACC
AAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATG
GTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAA
GGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTT
GCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGT
ACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCT
TGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGT
ACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTG
ATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTA
CAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCA
GCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCAT
CACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGA
AGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAA
TCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACC
AACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAG
GATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAG
ATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAAT
ATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGG
GGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATG
GGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGA
GCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGAT
CCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTC
ATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTT
TGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCA
GGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTG
AGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAG
TACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGG
GACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTG
ACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCC
GACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGA
GCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGA
TATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGA
GCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCA
CGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACAC
CCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGAC
ACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGT
TCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAG
GTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTT
ACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCC
TGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAA
CTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGAT
GATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGG
TCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATG
GTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTC
AGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAG
TGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAG
AAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGA
GACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGG
CAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACA
TTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCA
GGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTA
CGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGT
CTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACA
ACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTC
TAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTT
CAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCC
TACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCC
ATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGG
CAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTT
GTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAA
GGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATG
TACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTC
AGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTG
CCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATG
GCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAG
ACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTT
ACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCA
CCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGC
TGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCC
TGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACC
CCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATC
CGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGA
TACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTT
CCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAG
CACATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGG
TCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGG
CCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACC
AAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGG
TTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAG
GTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTAC
CAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACA
ATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGAC
TTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTC
ATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAA
CAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAG
AACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGC
TCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAA
ACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACT
ATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTG
CAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTA
CCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATG
GGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCAC
AACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCA
TGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAG
GCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAG
ACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCT
CTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAG
TTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATA
GAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAA
ACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAA
AAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTA
ACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAA
ACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGG
ATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAA
AGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGG
TTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGT
ATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGAT
GCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTT
CCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAG
GAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGAC
GGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATA
TGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACT
ACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGA
CATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCT
TACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGC
CTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACT
GGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGG
TCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGT
CTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGA
AACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCT
CAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGG
AGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAA
ACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACA
GTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTT
CATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAAC
CCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTG
GGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCC
AGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTG
TCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGA
AGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCAT
TGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGC
AAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCT
GACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAA
CAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTT
GTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCAT
TCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCA
ATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCA
AGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTC
CTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCA
TGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGG
GATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCG
AATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTG
CCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGG
AGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGT
GTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGG
GGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGC
CAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCAC
CGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATG
CCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCA
CTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGA
TCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCA
CAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAAC
ATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGT
CTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAAC
ATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATG
CACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCAT
GGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGC
GGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAA
AACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGA
CCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTC
GTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATG
AAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAA
CTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCA
ATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTT
ACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGC
AGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCC
CCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGA
AGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAG
TGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAG
GAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAG
GTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCT
ATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGG
AGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAG
CATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACC
ATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACA
TCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCT
GTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCG
AGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAAT
CCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAAT
GTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGA
CACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCA
TAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGG
GGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTC
AACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCC
CTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCAC
CTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACC
TAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAG
GATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACAC
GACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGT
CCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCT
CCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGAC
CGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCG
TCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATT
TAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCA
GGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCT
GTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACA
GCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACT
GATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGT
GGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAA
ACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTAC
CACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGA
GGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTG
GACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCA
GGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGG
AGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTG
GGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAG
GTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAG
TGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCA
TTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGG
GGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGC
AACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTC
TGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTAC
ACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAA
GTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCA
CCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCAT
GACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTAT
TCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGA
TTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGAC
CTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGG
TGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCT
GGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAAT
GGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAG
TTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATG
CCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCA
ACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATA
TGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAA
CTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGC
ATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTAC
TAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACC
TCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGG
GGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGAT
CGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCG
GCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGG
CGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGAC
GGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATA
TAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAA
GGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGT
ATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACA
ACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTC
TCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTT
CTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATG
GCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACC
CTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGG
ACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCA
ACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAG
CTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGA
CTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAA
CAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTC
AAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCA
GTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGT
ACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGA
GGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGC
CCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCA
TCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGG
AACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGG
AGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGA
AGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTG
TCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCAT
TCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGG
CCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGA
CGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGG
GACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAG
CCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTA
CGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACAT
TGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTT
ACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGG
TGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCT
TTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATA
GCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAAC
ACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGA
AACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGC
CCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGT
GAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGG
CAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGA
ACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGG
ATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCT
GCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTC
CAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTA
CATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGT
GCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCA
GAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGC
ATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAA
TGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTAC
ATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATC
GGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCT
TGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTT
ACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAG
ACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGG
AAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTG
GTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCT
GTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTA
TTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTG
GGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGAT
GGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCT
AGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGG
ATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGT
GGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACA
AAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAG
TGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAA
GCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCA
CGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCAT
ATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCA
CACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGC
CATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGT
TGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTT
GGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAG
GTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGA
TGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCG
GGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAG
TGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGG
AGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCA
CTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCAC
AGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGT
CAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTAC
GGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCG
CTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCAC
CACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGA
GGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGT
GGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAG
GAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACC
GGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGG
TGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCT
ATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCT
GGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCA
TCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTG
TCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACAC
ATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGC
ATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGA
TTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCC
ACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGAT
ATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTG
AATACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTT
GGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGG
CAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTG
GTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAAC
ATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGT
TGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTAC
GTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTA
GACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCA
GATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCG
TGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGAT
GTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGT
TGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAG
AGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACT
CGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAG
TGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTA
CAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAG
GAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGG
GGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTG
GCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGG
GGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTT
GGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGG
GCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATC
TGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGG
AGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAG
GGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTC
CTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTA
CCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAA
GTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACA
AACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCA
TAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCG
CATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCT
ACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGG
TGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCC
AGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATT
GGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCT
AACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAG
CAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATC
ACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGA
TGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACC
ATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGA
ACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCA
TCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGG
ACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACAT
GCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATC
TGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGG
AGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTG
TTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAG
TGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTC
TTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAAT
GGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTT
TGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGC
AGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCA
GTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCG
GAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTG
ATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGAT
GAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCT
GGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCA
ATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTAT
GCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCAC
ACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAA
CCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGG
GCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGG
CTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACT
CAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCAT
CATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAA
AAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGA
TCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTAC
CACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTC
ACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAA
TGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACA
GGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGA
AATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGAC
TAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTT
CTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCT
CCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCC
AGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCT
ATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGG
GGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAA
CCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCT
GTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAA
CCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATG
GAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTT
GCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACA
TGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAG
TGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACT
GCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGG
CAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTG
CCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGG
GGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGG
ATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTG
AAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACAC
CGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCA
CATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGA
TCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTAT
CACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTAC
CCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTG
ATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCAT
CGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTA
TCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTAC
ATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTC
ATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTA
CAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTA
CATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTC
ATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGA
AAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGAT
TTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGG
CAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGG
CCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATG
AACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGT
GGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGG
TGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAG
GCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGC
AATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGG
CGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCT
ACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGC
CTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCT
GTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAACC
TGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAG
GATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGC
TGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATT
CACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCAC
TTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAA
CCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCAT
TTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAAC
TCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGT
TCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATC
AGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCC
AGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAA
CTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTA
AGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTG
GTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGG
AACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGG
GACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTA
CCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGG
AGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGA
TGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCC
TCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCAT
CACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTG
GTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATC
GCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTT
CGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTG
GAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTG
GACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGA
ACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACAT
CACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGT
TATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGA
TCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTT
CTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATT
CGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGA
GAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCA
GTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCT
CAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAA
TCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTAC
ATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAG
CCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGG
AGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAA
ACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTT
GGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAAT
TAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCT
TCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGAC
GACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAG
CATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTC
AAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATG
GACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTC
AAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTG
GTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGA
GGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTC
TGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAG
GTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGAC
TACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGG
AGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAG
GTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGG
ATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGG
TGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGT
ACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCA
GGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTT
TAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTG
GTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAG
CATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGC
AACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGA
ACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGC
TATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCT
GAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAG
GAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTT
GATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGG
CCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAG
TCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGA
GAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTC
GTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGC
TCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTG
GTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGT
GAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCC
ACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGA
TCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTA
TCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTC
TCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGA
GGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGG
GCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGG
CAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCT
GTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGG
ATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATG
GGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGT
GGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCAC
ACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGG
AAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAA
TTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCA
TACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAG
CCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATC
ACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCC
AATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACC
AAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGT
GGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGA
TGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATG
CCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCC
TCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGA
AGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTG
GTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGA
GTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTT
CCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATC
GCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGAC
ATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATC
AGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGG
ATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAAT
GAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGG
GATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTG
AATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCC
TCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGG
GCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCA
CACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCAC
AAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAA
CATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGA
AGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATC
GAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGA
TGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGAC
GAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCT
ACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCA
TCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGG
AAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGA
ACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAA
CTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGA
TCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCAT
TACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGC
ACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCA
GACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTT
AACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCAT
CTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTG
TCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTT
GTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACA
TCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAA
CCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTT
GTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACT
TGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGA
GTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAAC
CGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTC
CCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCG
GCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTC
AACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACA
GGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGC
TCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGC
AGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATT
GATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTG
AGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAG
AAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAAC
TTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCC
TGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGA
GGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGG
CGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCA
GCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAAC
GGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTAC
CCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATG
GTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGA
GGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTC
TTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGT
GTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAA
CATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGC
CATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGC
CCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTT
GAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAAC
ACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCAT
ACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCA
GTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGA
CCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCAC
CTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCT
CATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACA
CGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTG
TGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTC
GACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGG
TATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGG
ACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACAC
AGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGG
GATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGA
GTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTAC
GGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACT
GATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCT
GGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAAC
GGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCAT
CTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATG
GAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGT
GGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAA
CTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATG
GTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACA
CTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCAT
TCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGC
CACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTT
GAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCC
GGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGT
CTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCA
GAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGG
CCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAG
TACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCT
CTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTT
TGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAA
CAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAA
GGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACAT
AACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCT
ACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACC
AGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGG
TGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCAT
TCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGA
GGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGT
CAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTG
GAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATC
ACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGG
GTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTG
GAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACA
GCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCA
CCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGA
GCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCG
TTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGG
GAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACC
TAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTC
CACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGT
CATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCT
ACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTA
TTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAAT
CAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGT
CTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGT
GCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGAC
TGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACA
TGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGAT
GCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCA
ACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTG
GAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTAT
GGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAG
AGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGA
AAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCA
AGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTAC
TGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTG
CAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTC
TACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGT
CTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTG
TTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAAC
AATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTT
GGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCG
GTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCT
CACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAAC
TTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGG
TGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTC
TTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAA
CACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCT
GTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACT
GTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGC
TTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACA
GGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGG
TCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGC
AGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGC
AGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTAC
GAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACAC
TTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTT
ACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTG
TATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGG
TGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATG
GTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATC
CAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGA
TCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGA
GGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCT
GGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGG
AGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAG
CCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGA
AGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAA
TGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAG
GGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACT
GCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGG
CTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAG
CTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGT
GCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGG
CACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAG
GCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAG
AGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATA
CCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCA
GCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTT
TTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAA
CACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACC
GTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGAT
GTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCT
TGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATG
GCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTT
CATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGA
GTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGG
TGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAAT
GCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGC
AACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAG
CAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACAT
CGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGG
GATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTG
GCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGA
GGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCT
CCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAG
GGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAA
GTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGG
TGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGT
ACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACT
GTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCG
AGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTAC
AGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTG
TCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGG
TACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCT
CCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTC
ACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTG
CATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGAC
AGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACA
CAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCA
AAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCA
TGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAG
CTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGA
ATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTG
GAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACA
GGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAA
CAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAG
CAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTAT
ATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATG
CAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATG
TGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTA
ACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGT
GCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTT
CTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGT
GATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGG
TGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATG
GATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTC
TTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTC
CAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGG
GCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACC
CACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTA
CATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAG
CAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGT
GGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCT
GCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCAC
AAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTC
TACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTC
CTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTAC
CAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTT
CTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCT
TGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGG
GATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAG
ACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCC
TGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCG
TAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGAT
GGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAAC
TGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGC
AGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAG
GTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGA
AGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGAC
ATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGA
ACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGA
GACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTG
GAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCC
ACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTC
GCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAG
CAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGT
TATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGA
CTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATG
GTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACT
ACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGAT
TCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACA
TCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTG
CCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCA
CACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGA
ATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACA
GTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGAT
GAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAG
CTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGG
ATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCA
GTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGG
GTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGG
ACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGA
CTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACT
CGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAA
TTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCA
ACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATG
TCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACAC
ATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCC
CTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCA
CAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATA
CAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGG
AAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGG
TACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCA
GGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCAT
GCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAG
GCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAAC
GACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCC
TGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAG
GGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGAC
TTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCAT
CAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGA
ATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGA
GAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGAT
GTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCC
GAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGC
GTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCA
TGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTG
CTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATT
ATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGA
CTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAAT
CAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAG
TTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGG
CCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAA
CAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATT
GACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGC
ACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGG
ACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAA
CATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACAT
TGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCG
AGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGT
GGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGAT
AGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAG
ATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCA
CAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGG
CACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCT
TCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCA
ATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGC
TAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAA
GCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCT
AACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGG
TGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTT
ATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAG
CAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCA
CCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGA
ATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAA
GCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCA
CGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCA
TTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATG
ATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGA
TCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGA
CAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTC
CATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGG
AGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGC
TCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATC
AATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGG
GAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGA
TCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGT
GATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCG
TCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTT
GTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAAC
CTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGG
CATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGG
ATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTG
AATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGC
ACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAG
ACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTC
TCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGG
TGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTC
TGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGA
AGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCT
GTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAG
TGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTAT
AACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCA
TACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGA
CTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATC
AACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCAT
AACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCC
AGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAA
CTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCT
GTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACC
GCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGG
ACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCT
GGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCA
ACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAG
GACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGT
CTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGA
CTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTG
TTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAA
CACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAA
CGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTG
ACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTT
TAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCA
ACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTC
GAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAG
TGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATG
TTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACA
GGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCA
TGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCAC
TGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAAT
GGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGG
TGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCT
CTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGC
GGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGT
CACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCG
TCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTG
AAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCA
TGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAAT
CAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGAT
GAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAG
TACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAG
GTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGAC
ATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTT
ATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCA
TTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTG
TGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGC
CAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAA
ACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGA
GGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCAT
TGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGG
AAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGA
TCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATA
CTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTG
GGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTT
GTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGC
CAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCA
TCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACG
GGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCG
CATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGG
TACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTAC
ATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGA
CAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGA
TCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTAT
AGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTC
TCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCA
GCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTT
CCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGA
CAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCT
ATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAG
GAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGAT
CTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATG
CCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCT
TTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATC
ATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTA
GCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGAC
TACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTT
TTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACC
TCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGA
GGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTT
TGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGG
TCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACG
ACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTC
AAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCC
ATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGT
ACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAA
TGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCT
TCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCT
CATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGC
CCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAG
TGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATC
TTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGG
CCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGT
ACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGAT
GGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACC
TGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTA
CCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATC
AACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCT
CTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAG
ACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAG
GATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTT
TTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTC
TGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTG
TATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGG
CCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATG
TGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGA
ATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGAC
TTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACAT
CAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCAT
GGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCAT
CATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTG
CTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGT
GGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGG
ACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAG
GGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGAC
TTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGG
TGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGA
AACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGA
GGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGA
TGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCAT
CCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTG
AGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCT
CCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAG
GGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTC
AGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGG
GACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAA
CACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGA
CTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTG
TCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCT
CAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCA
CTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACA
TGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGG
GGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTC
ATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGA
CAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGA
GACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAA
ATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGC
CTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCA
TGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCA
ACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAG
TGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAG
TCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAAC
CTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGAC
ACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGG
ATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATT
ACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGG
TACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTA
GGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACC
CACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGA
TGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAG
GGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTAT
GAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGG
CAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGA
CAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCA
GATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTG
TAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCT
CGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCC
ATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAA
GGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAA
CAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCGAC
AATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATAC
TGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCC
AACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAA
ATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAA
TGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGC
ATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTG
CCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAAT
CACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACG
TGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGA
GGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCT
TGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGC
CAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGG
TTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGA
TGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACA
ACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGT
TCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACC
TGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCA
GTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGG
TTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGG
TGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTT
GGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGA
GGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCG
AATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGG
CATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAG
GGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGA
ACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTG
GCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGG
ATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTA
TCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAA
CTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGA
GACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGA
ACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGAT
ATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATT
GAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGA
GCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACT
ACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCC
AGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTT
GATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGG
CAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGA
GGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGG
CAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAG
GGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTC
TACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGG
TGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAG
ACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGT
GCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTAC
AGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTT
CCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAAC
AACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGA
TGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGA
GCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCA
TCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACC
AGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTG
TCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCC
CCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGA
TCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTG
ACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGC
GCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAAC
TGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCT
CATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTAT
GTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGA
AGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATA
GAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAAC
CAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGT
GATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCC
TACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTT
GCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGA
GAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGC
TTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGAT
GGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCC
TGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCC
AAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCAAT
CTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGT
GACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTG
ACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACC
TCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGG
TGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGC
TTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGA
TATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAA
TGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAA
TAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAA
AGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAG
CATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCA
ACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGT
GTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGC
TTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATA
TTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATC
AACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGA
CCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTG
GCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTG
CACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGA
TGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGA
TGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTAT
CTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCA
GCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCA
ACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCC
TATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACAT
AAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACA
GCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTAC
GTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGT
AGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCC
CAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGT
GGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGG
GTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAG
GGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCAC
TTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGG
AGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTC
TCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGT
TCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGC
TGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACG
GAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAG
GGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAA
CCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTC
TAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGA
GTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAA
TGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTT
ACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTT
ACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCT
GACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACC
ACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTT
GACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGT
AAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTC
AGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACC
TCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCA
TTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTG
AAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACC
GGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAG
AGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACAC
TTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCAC
TTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACT
TGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAA
CCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTG
ACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGA
CCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAA
CTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGA
GTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGG
TCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTA
TCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTT
GGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGT
TGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAG
CAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGAT
GGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGA
GTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACA
CACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCT
GAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAA
CCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATG
ATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACAAC
TTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACAC
CAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGT
CAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTC
ATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATG
GCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATG
GGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCT
GCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGC
GACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGG
GAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATA
AAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAA
CTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATG
GACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGT
GGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGT
GGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAG
TTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGC
CATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGC
CTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACA
GTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTT
CGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATA
TGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGG
AAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGA
GGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAG
CCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGA
CAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATA
TACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGA
AGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATG
CACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGAC
AGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGT
CCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACA
AGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCC
CACAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCT
CATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTC
ACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTAC
TTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGG
GGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGG
GAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTT
GAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCT
TGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACT
ACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGAT
GAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTA
CGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCT
TTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGG
CAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCA
CGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATG
GAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACA
ATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACT
GGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACG
GAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTT
ATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCG
ACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTG
CGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGA
CACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCAC
TGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTC
TCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCA
TACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCG
GGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGA
CAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGA
AATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACAT
CATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACC
ACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTAC
TTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGG
GAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTT
TTATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAATGGA
GGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGT
GACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACT
TTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTAC
GGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAG
TCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTG
GCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTC
AGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAAT
GATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAG
ATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGG
ACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCA
AGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAA
TCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCAC
GGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGG
ACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGA
CTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCT
GGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGAC
TGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAG
GTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAAC
GTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGA
TGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGA
ACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCC
CAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGC
TGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTG
GGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAA
CCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCG
CACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTA
TCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTT
CCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTT
CGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACC
CTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGG
ACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCA
TTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAG
GACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGG
ACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAG
GTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCT
TCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGC
CCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGT
GGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGG
AGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATAT
CTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAG
TGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACA
AGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCA
GCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGG
CATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCA
CAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGT
GGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGG
ACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATG
GTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATC
ACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGG
AGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGG
AGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACA
AATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGAC
AATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGT
CAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGAC
TGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAAC
ACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCA
ACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGT
CGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGT
GACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATG
TAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACG
GGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGA
AATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAAC
TGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTAC
ACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCC
AGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATG
GAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTT
GATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGG
AGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGAT
CTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGG
TCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACA
TATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGT
TCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACG
GTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGC
AGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATG
GAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAA
GGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCA
TGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCT
ATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGC
AGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGT
TGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCA
CCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATT
GATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTG
GCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTG
GAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCC
ATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGG
AGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAAC
ACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAAC
AATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCG
TGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCA
CCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATC
CACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGT
GGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATG
TTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCA
GTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCT
CAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTG
ATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGC
AACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGT
TCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAA
TAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGG
ACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGG
TGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAG
CAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGC
CATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGC
CTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACG
GGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGAT
GTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTC
TGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCG
TGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCA
CCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTA
CTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTC
AGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATC
AACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGG
GTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCG
GACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACT
GTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTA
TTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACA
GAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTG
TACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAAC
AGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAG
ACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAG
TATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCT
TGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGT
TTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCA
CCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGA
ATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAG
AAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTG
GTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACAT
CCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGC
CACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGAC
ACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCA
CCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTG
GAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGA
CAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGA
ACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGG
ATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGC
AGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGG
TTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAA
ACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGG
AGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGA
CGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAG
GTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGAC
GGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCAC
TGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACA
ACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCA
GGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGAC
ACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCA
ACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGG
AAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTA
TGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGA
TAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATT
GATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGT
CGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACC
GCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAAT
GCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCAC
GCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGG
TGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATG
CATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAA
TGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGA
ACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTT
ATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGT
CAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTC
CAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGT
GGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGG
CTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAG
GTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATT
GAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGG
AGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGA
CTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGC
GGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGA
ATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCT
TCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAAT
GGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCA
AGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATG
TCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGG
ACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGT
TGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTC
CCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAAC
ACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAA
GGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATA
GCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGG
GATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTG
TGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCA
TTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAAT
GGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAA
GGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTG
CCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGC
GCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGA
GAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAAT
ACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAG
GTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTA
CTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGG
AGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCAC
CATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGA
CTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGC
TAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACT
CAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCAC
GATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAG
ATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTG
TCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCT
AGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATG
ATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTC
TTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTA
TGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTG
ATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGA
GGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAA
AGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCAT
CCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATC
AACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGC
AGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCT
ACCACATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTA
GAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAAC
CGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTG
CCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCT
GCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTT
CTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGA
ATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACA
CGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCA
CAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTA
CACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAG
GGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAA
TGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTT
TTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACA
CGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCT
AGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAG
AGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGT
TGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGAC
TCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCG
GTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACG
GGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCA
CGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCT
ACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTAC
CACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTA
CTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTT
ATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGT
GGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACT
GCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCA
ACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAG
GCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGA
GCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGG
ACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGA
AGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCAT
TGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTG
CCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATG
GACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTT
CCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACG
GCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTT
GCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGG
AGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGG
AAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCT
GAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGG
TAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTT
GTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAG
TTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCT
TGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAA
ACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGC
AGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATAC
TGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAA
GTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCAC
GCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTT
AGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAG
GGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCAC
AAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAG
CAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCT
CTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTAC
TGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTA
TTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATG
TCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGT
AAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAG
TGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACC
TACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACA
TCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTA
TGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACA
GTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTT
GACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAA
CGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACA
AGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTG
ACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACT
GGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTG
GCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTG
TACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAG
CCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCAT
ATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTATAT
GGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACA
TCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCT
TTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCT
GGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGG
CAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGAT
CCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGAC
TATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCG
GAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGAC
ACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGT
GTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGA
GTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTG
GTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTAC
TCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAA
CAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGA
ATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGC
ATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCT
GTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGC
TTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGC
AATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGT
GCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGA
AGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAAC
ACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCAT
GCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACT
TAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACC
AGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGC
TGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACG
TCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAAT
GATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTT
CCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGA
GATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGA
GGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGA
CTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCA
GCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATG
GACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGAC
CAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGAC
ACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGC
CCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAG
GAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACA
AAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCAC
AATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATC
CCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTA
CGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAA
ACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCA
CTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCA
CTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATC
GACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTT
CAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTT
ACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCT
GTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGC
CCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCAC
GAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGC
AGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGA
TGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCA
GCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACC
ATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCC
ATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTA
CAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATA
CAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGA
TCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAA
TGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACA
TTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCA
CTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAG
GTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCG
TCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTC
CCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGT
TTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGT
GGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTT
TCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAA
GTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTG
GTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGG
AGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACT
TCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGT
CCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACT
TCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCA
CCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGA
CCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTC
CACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTG
ATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAG
CTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCC
AAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTG
GGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCAT
CTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGG
AGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCA
ACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAG
ATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCAT
CAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAAC
GTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACA
TCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGG
ATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTG
CAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGT
GGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTT
CCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTG
GCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGT
GTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGG
CAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGA
AGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGG
ATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTC
AGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCA
AAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTAT
AACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGA
TGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCC
TGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTA
CATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCG
TGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCA
ACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTAC
CTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTC
AGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATC
CAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAAC
GCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGA
TGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCT
TGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGA
CATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGG
CTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCT
ATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCAC
CTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGT
CTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGA
TTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAA
CTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGG
AGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTC
ATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGA
GGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAG
CCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATG
CTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCC
TTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACT
CGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGAT
TAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTC
CATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTC
AGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTC
ATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGC
AGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGG
AACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTG
ATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGA
GGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATA
TGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCAC
CCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAAC
CAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGA
CCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACA
TGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCC
AAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGG
TTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATG
GTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCAT
CTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCT
GTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAG
TGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTT
TACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGT
CAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGC
ATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATG
GAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCAC
AATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACA
CCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTC
AGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGC
AGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCA
ATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCAT
GGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATA
TGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGA
GAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTG
ATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACG
TCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCT
TTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGAC
CAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCG
TGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAG
AGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCA
GGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGAT
TGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATT
CCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGT
GAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACA
GATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAG
GAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATC
CACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACAC
ACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTG
ACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCAT
GTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGAC
AGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTG
TTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCAT
CCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGG
AACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAG
ATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTT
GGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCA
TGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGAC
TCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGC
AGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATAT
AGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCA
GAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGT
GGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACA
CATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTG
CAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTT
TACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGA
GTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACA
CAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATC
TCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGT
TTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATT
CCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTG
CCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCT
GGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACT
TTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTC
AAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTA
TGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTG
TCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCC
TGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAA
TGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAA
AGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAG
TTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACT
CACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTG
GCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGAT
CCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTA
CCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGA
TCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTC
GATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTC
TTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACA
AGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGC
GGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGT
GGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCA
CCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAG
GGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGG
AGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCT
ACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGA
CAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGG
ACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCC
TCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCAT
AACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGA
AGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATG
GCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAG
AAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAA
CTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCT
TGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCT
TACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGA
TGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACC
ACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCC
CATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGG
AGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACC
AGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAG
CTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGA
AGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTA
TAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGA
AAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGG
AAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTG
TAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTC
AAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGC
GGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATG
AAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGC
GGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCAT
GTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTG
ATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACT
TTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTC
AGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGG
ACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGA
TATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAA
CTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTG
GACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAAC
CTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGA
GCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAA
CTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACA
GGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTT
GTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAG
GAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCAT
CTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGT
GGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACATTG
AAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTA
CAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGG
TTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGA
ACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCC
TGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGAT
CCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGT
TGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGG
GAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTC
ATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGT
GCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAAT
CTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTAC
AACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGG
TTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCC
ATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACAT
CAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTAT
CAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGT
TCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTC
CATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCA
GGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGG
CGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAAC
TGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAG
GGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGAT
GTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGG
GGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAG
GCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGC
ACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGA
TGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAAC
CACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGA
GATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATC
CACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAA
ACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCAC
GTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGA
ACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAA
TGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCC
ATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACT
GCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTG
AAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATT
GACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAAT
TCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCA
TGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACC
AACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCAT
CAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCC
TTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGA
GCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCT
CCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGG
GAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTA
AGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGG
AGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATAC
AGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCT
CTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGG
GGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAAC
AGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAA
CCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCA
CATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGT
CTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTC
CGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGA
ATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCA
ATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAG
GACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGT
CATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCG
GGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACC
TCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACAC
CCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATC
ACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAA
CCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCG
AGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGAC
ACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCA
GTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCAC
CTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAG
ACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCAT
CGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTA
TTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGG
CAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTC
CTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTA
CAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCA
CTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTT
GTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGA
AAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGT
ACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGA
GAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGC
TGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAG
CAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCT
GGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGG
TGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAG
AGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGA
AGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCG
CATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAG
GGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACA
GCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAAC
TCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGT
ACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGAC
AAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCG
CACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCC
ATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCT
ATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACAT
GATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGG
ACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGT
GGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCAT
CTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACA
ATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCA
AGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAA
TGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACG
CAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATA
TATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGG
AACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTG
GCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGT
ACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCA
CCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAG
GGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAG
ATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGG
CGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCG
GGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGG
ACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAA
TATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACA
AAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACA
GTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAA
CAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACC
TCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCAC
TTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATA
TGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAA
CCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTT
GGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTT
CAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTG
AGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCAT
GACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTC
AACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAG
TCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAG
CAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGT
GTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATG
GAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCA
GCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGG
CATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGA
GGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGT
GGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGT
GAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACT
TGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGC
ATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCA
GGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTG
GACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCA
GGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGG
AGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTC
TACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAAC
ATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAG
TTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACC
GGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATAC
CTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGA
TAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCA
ACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTT
GAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACT
GCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGAC
GTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCAT
GGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCA
GAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACAT
GGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACAT
CTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCAC
TCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGC
TACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGAT
GTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAG
CAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAG
GCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACT
AATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCT
ACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACA
TCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCAT
CTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCAT
TTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGG
AGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTAT
GGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCG
TGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAAC
CTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTG
TATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGG
TGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCG
ATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGC
CTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACT
GGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTG
GTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTA
CAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGA
AGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAG
AAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCC
CACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTC
ATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACT
CACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTG
GCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAG
GTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTT
TTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTAC
AGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTG
GATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGT
CGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCC
AGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAAT
GGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACAT
CACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTC
ACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATAT
GTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTT
ACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCC
CGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTC
ACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAG
GAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGG
GTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGG
AGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGA
CCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGT
GGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACAC
CTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATG
CTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACC
CATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCG
TGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGAC
ACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCT
GCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAG
GATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACC
CCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGG
ATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAG
TGAATACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTC
TTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTG
GGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATC
TGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAA
ACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTT
GTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGT
ACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTG
TAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGC
CAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGT
CGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGG
ATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACA
GTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAAC
AGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGA
CTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGC
AGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGT
TACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGC
AGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCC
GGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGT
TGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATG
GGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATT
TTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAA
GGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTA
TCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCA
GGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGC
AGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGT
TCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTG
TACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCAC
AAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCA
CAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCT
CATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAAT
CGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATAC
CTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTAT
GGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCT
CCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACA
TTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGAC
CTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGC
AGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACA
TCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTT
GATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAA
CCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGG
GAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTG
CATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGT
GGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACAC
ATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCA
TCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCA
GGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTC
TGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCA
AGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAG
TCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGA
ATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATAC
TTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGG
GCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATT
CAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCC
CGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCT
TGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGG
ATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGAC
CTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCAT
CAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCT
ATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACC
ACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGC
AACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAG
GGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACA
GGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGA
CTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGC
ATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGA
AAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATG
GATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACT
ACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTG
TCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCAC
AATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGA
CAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCT
GAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGG
ACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTG
TTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGG
CTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTT
CCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATC
CTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAA
GGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACAT
AACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACC
CTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTA
AACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACA
TGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGT
TTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGA
CATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGG
AGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTA
CTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGA
GGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGC
TGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAG
GGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACA
GGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGC
TGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACAC
ACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTC
CACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTG
GATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACT
ATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTT
ACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGG
TGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCC
ATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCT
TATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTT
ACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCC
TCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTAC
TACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCAT
TACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCG
TCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCA
GAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGG
ATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTG
GGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGC
GGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTA
TGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGAC
GTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGAC
GGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGG
AGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTG
GCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGT
GGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAAC
CTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCA
GCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTT
CTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAA
CCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTC
AGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTT
GCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAA
TTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCC
ACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCA
AACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTC
ATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGA
ACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTA
GTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAA
TCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGG
CCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTAC
AACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAG
TAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGAC
TGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCA
GGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGG
GGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACC
TACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCA
GGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAG
GATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTT
CCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTC
ATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCT
TGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCA
TCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACC
TTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTC
TGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTG
TGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGG
GAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACAC
ATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTT
GTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTT
GATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAG
TTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCA
TTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACA
GAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAG
CAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGG
CTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGC
AATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTT
ACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTG
AGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTT
GGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGT
AAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATG
TTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCA
ATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGC
CTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAG
ACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGC
AGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGT
TCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCA
TGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTG
TCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTC
TGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCA
GAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAAC
TCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAA
AGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAG
ACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTAT
GGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCG
AGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGA
GGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCA
GGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGG
GTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAG
CAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAG
TTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGG
TGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCC
AGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCA
GCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGA
GAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACA
GCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATC
CTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCT
AGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGAT
TTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTAT
GGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGA
AGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTG
GAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGT
TCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGAT
GCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTG
TGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCT
GTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGG
CCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGG
GATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCC
TATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACG
TCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGAC
GAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAA
GGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGG
GGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCT
CTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCT
GGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGA
TGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCG
GTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGC
ACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCA
GGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAG
AATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATAC
CATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCA
AGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCA
TCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTC
CCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATA
CCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGAT
GTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGG
GATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGA
TGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTG
CCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCA
GAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGG
TGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACA
GAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATG
TTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCA
TCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGG
ACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGA
TCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCT
GGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGA
ATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGA
GGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGT
TGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGG
CCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCA
GGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCAT
CACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGC
ACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTG
AACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGG
GAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGA
TCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGA
GATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGG
ACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTG
CTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTC
CATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGA
GGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACC
GAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGA
AACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATG
GATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCC
ATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGA
GCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGAT
CAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCT
TTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACC
ATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGG
TGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAG
TTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGA
CATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGG
AACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACAT
TTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTA
CTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGG
GAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCA
ACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCC
TCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTT
CGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCG
TCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGA
CAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCA
GCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAG
GCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAA
TTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGC
TGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGG
AGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGA
ACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGT
CCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAG
GAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCA
GGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATAT
CAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGA
ACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTT
ACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAA
TGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTG
GAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTC
TCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGA
GTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATG
AACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAG
GCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCT
GCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACT
TTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCA
ACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCC
ATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTG
CAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATA
GACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGC
ACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTG
CTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAA
CACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTT
TGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCG
TCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGT
GGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGT
GGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTAC
ACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTT
GGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGG
GAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCT
ACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGA
CTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGAT
CTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAA
ACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGC
ATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAA
TGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTG
GTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTC
AACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAA
TGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAA
CACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATC
ATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTT
GCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACT
TTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCAC
CCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCG
GTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGAC
CAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTT
GGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGG
AGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGT
CTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAAC
TTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATC
AACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTG
AAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAAC
ATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGC
CTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGA
CCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGT
GGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACC
ATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCG
GAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAG
GTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAG
TGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATA
TCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGA
GGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACAT
TGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTA
CAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTAC
CACCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAG
GAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATT
CGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCA
GGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACA
CCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTC
TCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAA
GTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGT
CTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTG
TATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTA
ATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGAT
GTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGT
GTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTG
ACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAA
CATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGG
ATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACC
CAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACG
TGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGT
ATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGAC
AGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCT
GAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCT
CAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACT
ACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGG
TGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAG
TCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGAT
GTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAAC
TGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACA
ACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGT
TTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACG
CGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATC
CTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAA
ACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGC
GGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTG
TCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAAC
AACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTAC
CTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAA
CTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTT
GCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGA
CAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAG
GGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGAT
GCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACAT
GCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGT
ACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAAC
ACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTT
TTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACC
TGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATC
GGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGA
TGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACA
TCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAAT
GATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGG
GAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGAT
CTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCA
GGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCA
AGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACG
GAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGAC
AATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGG
AGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCA
CTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGT
GGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGG
AGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAG
GTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAAC
GGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTC
AGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATA
AGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACA
TACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACAT
CAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATG
TTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGC
AACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGA
CCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATG
ATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCAT
CTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAA
TGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAAC
TTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTAT
GAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTC
GGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTA
ATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAAT
GCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTC
AGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCAC
ATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGT
GGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCC
TGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAG
GAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGT
CTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGG
AGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGG
AAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCG
GGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGA
GTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCA
CTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTG
CGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGT
ACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTG
TGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACT
GGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCC
CTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACAC
TCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATG
TGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGG
ACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGA
CACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTT
CAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCAC
CATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCAC
AGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAA
GAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGG
TGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGA
CAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCAT
AACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGG
AGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCT
ATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGA
TGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCA
TGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAG
TAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATG
GTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATC
TTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTG
GTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCAT
GGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACA
TGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGG
TCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATC
TCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTG
GGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGA
CCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGG
TACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAAC
AGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCG
GTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGT
CTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGC
ACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACAC
TCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTG
TCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCT
ACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACT
TTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACAT
CTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACT
GGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACC
AGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTAT
CCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCAC
CGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAG
ATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCA
ACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTT
GCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTAC
AGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCT
GAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGG
ACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTG
GAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAG
GAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAG
TGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACG
CCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGAC
TCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCAC
AGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTG
GTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATG
GACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCA
TGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAA
CTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGG
ATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGA
CATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTC
TGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGAT
CACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTT
GAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTA
CAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTG
ATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGG
AGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGAC
GGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTAC
CAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGA
GGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATA
GGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATT
GACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGA
CTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGG
AATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACAC
CAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAA
TGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTAC
ACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTC
CCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGT
CACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATA
TACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGA
GGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAG
GGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACC
CAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATC
ATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTC
AGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTA
ACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATT
CCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGG
AGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAG
ACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATC
ATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGAT
GAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTG
GAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGG
ATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGG
CCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCC
GCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTAC
CATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGG
TGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCA
TTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCT
GACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACA
ATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGG
AGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTC
GGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGG
AACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGA
TTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTT
GCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACT
GGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGG
AACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGAC
ATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAAC
CGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTG
GTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACG
ATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTC
AGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTC
CACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTT
GGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCT
CTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAG
CAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGA
GCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGG
AAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTG
CTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCG
GGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAAC
TTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTG
AGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTG
CACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAA
GAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCA
AAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAAC
CACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGC
CATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACA
TGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATG
GATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCA
GACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTG
TCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAAT
GGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAG
GCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTA
TCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCA
GGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAA
GATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCA
GTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACAT
CGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGG
TTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCA
ACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGA
GGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGT
GGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTC
TGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGT
GCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGG
AGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACT
TCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTAT
GGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTT
TCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATG
GAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGAT
CTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGG
AGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACT
ATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTC
CATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTT
GACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCA
TCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACC
ATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCG
CCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAA
AACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCT
CTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTA
CCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTG
GGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAG
CTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGAT
CAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGC
AGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTAC
GTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCA
GACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATG
TGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTA
AACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGG
AACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAAC
TGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGG
TTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGAT
CAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTT
TCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGA
AGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAA
TGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTA
CAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAG
CATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGC
ACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAA
ATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCG
GGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGT
CTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAG
GCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACA
GTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCAC
CGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCC
TGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAG
CATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCA
ATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTG
ATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACG
AGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTAC
AGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTG
ACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAG
TTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCAC
CATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATT
TGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGT
GCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAA
AAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAG
GAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACC
ATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGA
GGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTG
GATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATA
TACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAG
TGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAG
TTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCAT
GCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAG
CATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAA
CGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGG
CGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAA
GGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTT
ACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTC
GACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCA
GATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTT
ATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACT
TCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTC
CAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCT
TTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATA
GACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGAT
CTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGC
AGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAG
ATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGA
TGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCC
CTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCA
TCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGT
TAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTG
ACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGG
TTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAA
CCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCC
GAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAG
TTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGT
GGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTA
CGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGG
TCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGC
CCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATG
GTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGG
AATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATC
CTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCC
CTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAAT
GCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTC
AGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACA
TCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATG
GGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGT
GTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGG
ATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAA
CCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGT
TACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACA
TCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCC
CTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGA
AGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTG
AGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGC
TTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATC
TCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTT
TGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGA
GGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGA
TGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAG
GAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAG
ACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGAC
ATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGC
ATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTC
ATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTC
TGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAG
GTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACA
GGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGG
AGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAG
ACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCA
GGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAG
GAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATG
GAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTT
GATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGC
ATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCC
TGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCC
CTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGG
AGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGG
TCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACA
GGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGC
AACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGG
GACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAAC
TGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGG
CTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAG
CACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCA
CATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGG
GGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCC
TCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGG
GACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGG
GAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTAC
AAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAA
GCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTC
CATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAG
CAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTC
AGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGA
AGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGA
ACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGG
ACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACA
GGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAA
TTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCAC
GGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGG
TAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACA
CCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGAT
GATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAG
AGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGT
ATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAAT
GGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGT
GACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGG
CAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTAC
TGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGG
CTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGG
CCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCA
AAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGG
AACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCG
ACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTAT
ACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGG
CCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGC
AAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTC
AATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGT
GCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACT
TGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCA
ATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCA
CGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATG
GAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTC
CTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGA
GCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGA
GGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGAT
GATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTA
CAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGG
GTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACA
CCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGG
CAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTT
GGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAAT
GGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCAT
TTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACG
GAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGC
CGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCA
GGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGC
AGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCAC
GAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGT
TGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTT
GGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGAC
TATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCT
AACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTG
GAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTG
GAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGG
ATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATA
TTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGC
GAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAA
CTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATG
CCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAG
TTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCT
GGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATG
GAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTT
GGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGG
AGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCT
TCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATC
GGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGG
AGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATG
GTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTT
ACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCC
TTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCA
ACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGA
GATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAA
GAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAG
CATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCA
CCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTC
TGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACC
CCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACT
GATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTT
TGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACT
GCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACA
ACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGG
CTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGT
ATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCG
GAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTA
TAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCA
ACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCG
GTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCG
CCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACT
TTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTAT
GAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGT
GCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTG
ATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACT
CCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTT
CCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCA
ATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAAT
GTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCT
TGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAA
CCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGA
GGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGG
GCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAG
GATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGC
AATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAA
AATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAG
AAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGA
AGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGC
CAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGAC
GTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACA
GCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTA
TATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGA
TCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGT
GACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGG
TGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGC
TGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACA
GATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGT
GATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCT
ATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCT
CAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGC
CAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGT
CCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAAC
ATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGA
CAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCT
ACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGAT
GTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGG
CCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCG
GTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCG
GGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGG
AGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGC
ACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAAC
GGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCT
TCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTG
GTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATT
GCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACA
CGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTG
AGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAAC
AACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTC
TCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTG
GAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCT
AATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTC
TTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCAT
TTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGC
CTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAA
CCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGG
TTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTAT
GTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCAT
TCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTA
CCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATAC
CATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTT
TGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACA
CCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCT
AGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCAC
ACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCC
ACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTA
CTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAA
AACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTT
TGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAAT
GACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCT
AACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAG
GAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGT
GGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCT
TATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATC
TTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTC
GTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGC
AGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTG
ATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAG
GAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTA
CACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCT
CTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGAC
AACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCA
TGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACA
ACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTAC
ACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTT
GTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATG
TCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTA
TGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCA
TGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATG
CTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTG
GCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCA
GGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCA
TAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTC
AACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAA
TGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAG
GTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATT
GTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGG
AGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGA
GCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCC
GCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAA
CAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTG
TTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAA
TATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACT
GGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTG
GAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGA
AGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGG
GACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGA
TATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCC
GAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTA
TGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCG
ACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACC
GTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACA
CAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTC
CCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCAC
CTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAG
TCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGT
ACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGG
GGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCC
GGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCG
TTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAAT
CTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACA
CTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAG
ATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTG
TACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTT
CTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAG
GGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTC
CACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCA
TGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCA
CAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTA
CTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGA
CGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTT
TTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACT
CGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGAT
TGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACG
GACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTC
ACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGAC
TCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAAC
CATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAG
CGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGG
GACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATG
GAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAAC
ATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAA
CCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCT
ACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGT
GGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGC
TTTTATCTACCACATGGTGTACACACACCGAACACTCATTATCGACAATG
GAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGAC
GTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACA
CTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCT
ACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCA
AGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCT
TGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGT
TCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACA
ATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGA
AGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGA
GGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTC
CAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGG
AATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCC
ACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGC
GGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAG
GACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCT
CTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTG
ACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGC
AGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCA
ACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAG
GATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGAT
GAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGG
CCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATT
GCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATT
TGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAG
AACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACAT
CGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCC
TATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCC
TTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCAT
TTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGA
CCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACA
GGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGG
CATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCT
AGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGG
GGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTG
AGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCG
CTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCA
GCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATT
GTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGA
GGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGAT
ATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAAC
AGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTA
CAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACC
CAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGG
GGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACAT
CACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCA
GTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGT
GGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAA
TGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACA
TCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTT
GGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAA
GGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCA
CAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAG
ACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCAC
GTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCG
ACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAA
ACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCT
CAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCAT
GTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCT
GTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATA
TGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCA
CGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTT
GAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGA
ACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGT
ACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATG
CCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACA
TGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCG
TTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAG
GGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAG
ATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTG
GGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGA
CATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAAT
GTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAA
CGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACA
GCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCA
TGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAG
AAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGC
CATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGC
CTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATG
GCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCT
GTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAAC
CACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCA
TTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATC
TGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGG
TGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGG
CCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTAT
GGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGA
ACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACA
ACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTT
CGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCAT
CACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACA
TCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTG
GTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCA
TGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTAC
CAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGT
CTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACAT
TGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATG
GCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGT
GTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAG
AATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGA
GGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCA
GGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGG
AGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTG
GCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTT
GCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCA
CGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAG
ATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAG
TCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCAC
CGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTG
CACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTT
TACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGG
TCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTA
TCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAA
GGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGC
CGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTA
CTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTC
TATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTA
CAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCT
TGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACA
ACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACAC
AGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACC
AGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAG
CTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCT
GTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAG
CACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTT
GAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGG
AGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCC
TGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGAC
ATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCC
GCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTG
ACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGAT
CACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTT
TGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTG
GACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTT
GAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGT
GGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTG
GCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAG
GGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCC
AAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTG
GGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTG
GACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGG
AGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAG
ACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCC
ACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACA
CAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAAC
CAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAG
ACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTC
CAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAG
GGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGT
TATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGA
GATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCA
TTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCG
GTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGA
CCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCA
ATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACC
ACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGT
GGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAA
TGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTC
AATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACA
GAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAG
TTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGAT
GTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGG
TCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATG
GTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTAC
GGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGG
AGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTA
TTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGA
GGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGG
GACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTG
GCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTG
GAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGT
CTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACA
ATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGAC
CAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACA
TGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCA
GGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCAT
GTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGAT
TCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACA
ACACCTACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATC
AAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAA
TAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCA
GGGATAACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCT
TGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAAC
CATTTTCTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAA
ATGGTGGACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGAC
AAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTT
TGCCAGCTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAG
GCGCCCACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGAT
GAGAATGTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCA
ATACATGATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAG
AGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTC
TACTATGGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGT
GGAGATTCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCC
ACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAG
GACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAG
GCTAAATGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAA
CTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTC
ACGATACTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGC
AGATGGATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACC
TGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGG
CTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAA
TGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACG
TCTTCGGCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCC
TATGGTGGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAAT
TGATATTGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATG
GAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATC
AAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTC
ATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCA
TCAACAACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGG
GCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTAT
CTACCACATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGT
TAGAACCCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACA
ACCGACGGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTT
TGCCAATGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCT
CTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTG
TTCTTCCTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCAT
GAATCAAGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCA
CACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATC
CACAATGTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCT
TACACTGCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAG
AGGGCATGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGAC
AATGGCACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCAC
TTTTTACACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCA
CACGCCTCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTT
CTAGATGCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGC
AGAGATCAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAG
GTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGG
ACTCCATATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGG
CGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCA
CGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCC
CACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTC
CTACATCTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGT
ACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTG
TACTTTCGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGG
TTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCG
GTGGACCAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACA
CTGCTGATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGC
CAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCC
AGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAG
GAGCTACAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGT
GGACAGAGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTG
GAAGCATCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTC
ATTGACACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACT
TGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCA
TGGACCATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTT
TTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAA
CGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCT
TTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAG
GGAGGTGGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGAT
GGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGT
CTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGT
GGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGAC
TTGTAGACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTG
AGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATC
CTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGC
AAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAG
GCAGTGGTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACAT
ACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGG
AAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGC
ACGCATTTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCT
TTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTC
AGGGAACACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATC
ACAAGATCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATG
AGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAAC
CTCTAATTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGT
ACTGGCTGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAG
TATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAA
TGTCTACTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGA
GTAAATTCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACC
AGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAA
CCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGA
CATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATC
TATGTCAATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGA
CAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACAT
TTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGG
AACGGACTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGA
CAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATG
TGACAGATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAA
CTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTC
TGGCAAGATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGG
TGTACGTCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATC
AGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTC
ATATGACAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTAT
ATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAA
CATCTTGTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGG
CTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGAC
CTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGT
GGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGG
ATCCATCTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCG
ACTATGGACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTG
CGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAG
ACACTGCCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATG
GTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTA
GAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAAC
TGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCT
ACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGG
AACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCA
GAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATG
GCATCCCTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGAC
CTGTTAGATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTG
GCTTTACCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACG
GCAATGCCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAA
GTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGG
GAAGAACCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGA
ACACTCAGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGC
ATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGA
CTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACA
CCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGG
GCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGA
CGTCACTGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAA
ATGATCTCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGAT
TTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGG
GAGATATGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATG
GAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTAT
GACTCCATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGG
CAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCA
TGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGG
ACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGG
ACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAG
GCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTAC
AGGAACAACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGA
CAAAGCTGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACC
ACAATAACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCA
TCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACC
TACGTTAACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCC
AAACAACAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGG
CACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAG
CACTACAGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACA
TCGACCATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCC
TTCAAAGTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGG
TTACATTGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATG
CTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGAT
GCCCGTGGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGC
ACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTG
GCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTT
GATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGG
CAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGA
CCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTG
CCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACG
TACAGAGTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCA
TACAAAATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTG
GATCCTACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGA
AATGGAGGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGA
CATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTG
CACTACATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGA
AGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTC
CGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTAT
TCCCAGTCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACAC
GTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAG
GTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGC
TTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGG
AAGTGGAGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAG
TGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCA
GGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCA
CTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTG
GTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAA
CTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGT
CACCCAACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGA
GACCACGAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCT
TCCACATCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGC
TGATAGAAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATG
AGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGC
CCAAGGGAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCAC
TGGGAAAATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTC
ATCTCCCCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCAT
GGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGC
CAACTGTGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATG
AGATGATTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCC
ATCAAAATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCA
ACGTGTCATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCA
CATCGACCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAA
GGATCCATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGG
TGCAGGCCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGA
GTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCC
TTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGC
TGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAG
GTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGA
GGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGG
GAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAA
GGATGGCTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCC
TCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTT
CAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCT
ATAACCAACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCT
GATGATCACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGG
CCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGT
TACATGTCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGAC
CGTGGAGAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTT
CAACGTCAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCT
ACCTGCAGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGC
TCAGGTGTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTA
TCCAGCCGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATA
ACGCCACCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGT
GATGACACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTT
CTTGTATCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTG
GACATGAACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGAT
GGCTGCCGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAG
CTATGGACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCC
ACCTTGCAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAAT
GTCTTCACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACAT
GATTGGAGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGG
AACTCCATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTAT
GGAGGGTATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGAT
TCATCTGGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATG
GAGGCTTCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTC
AGCCACTACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAA
TGCTACCACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGG
CCTTCTTTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATA
CTCGCTGAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGG
ATTAGGGTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCC
TCCATGGAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGG
TCAGGAGCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGG
TCATGGAGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCG
GCAGTGCTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGT
GGAACTGGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATAT
TGATGGAGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTG
GAGGTGGAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGA
TATGGTCGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTC
ACCCGGAGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACA
ACCAAACAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGG
GACCAAACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCA
CATGGTGTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAAC
CCAAGGACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGAC
GGTTGCCGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAA
TGGTACCCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCC
ATCTTGCTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTC
CTGTACATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCA
AGTGATGGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTG
TTTACAGTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAAT
GTCAGCATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACT
GCATCACAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCA
TGGAAGCAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGC
ACAATCAATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTA
CACCAACGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCC
TCAGGATATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGAT
GCAGATGGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGAT
CAATATTGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCC
ATGGGGGTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCA
TATGGGCACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGA
GAGAGCAGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTG
TGATCCAGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAA
CGTCATGGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACAT
CTTTTGCGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACG
ACCAGGGGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTT
CGTGAGAATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGC
AGAGTACAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGAC
CAGGGACAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTG
ATTGACAACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTA
TTCCGACCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTG
GTGAGCACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTA
CAGATATATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAG
AGGAGCAACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCA
TCCACGTTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGAC
ACACCCTTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCC
TGACACTGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACC
ATGTTCATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTG
ACAGGTTCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCAC
TGTTACAGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTC
ATCCTGAGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGT
GGAACTGTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGT
AGATGATGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAAC
TTGGTCCAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGT
CATGGTGGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAG
ACTCAGGAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCG
GCAGTGGTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGAT
ATAGAAGTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAG
CAGAGACTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTG
GTGGCAGCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGA
CACATTCAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGG
TGCAGGTGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCAT
TTTACGCAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCC
GAGTCTGGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAA
CACAACTCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGA
TCTCTAACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGA
GTTTCAAGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAA
TTCCTACCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGC
TGCCATACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTC
CTGGCAGATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTA
CTTTGTCAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAAT
TCAAGGTTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGAC
TATGTACTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACC
TGTCAGACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGG
CCTGCCATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTC
AATGGCCAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGC
AAAGACATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACC
AGTTACATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGA
CTCACCACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGAC
TGGCTGGCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAG
ATCCTGATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAG
TACCCCAGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAA
GATCCGAGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACG
TCGATACTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTG
TCTTCCCTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGA
CAAGCACATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAG
GCGGTCATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTT
GTGGCCATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTT
CACCAAGGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTC
AGGGTTATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGT
GGAGGTCGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCAT
CTACCAACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATG
GACAATTGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGA
GGACTTGGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTG
CCTCATCGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTC
ATAACAGCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGT
GAAGAACTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCA
TGGCTCTGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCC
AGAAACTACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGC
AACTATGAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGC
CTTGCAAGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCC
CTTACCCCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTA
GATGGGTCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTA
CCACAACTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATG
CCCATGTGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAG
GGAGGCAGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAA
CCAGACTTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTC
AGCTCTACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGG
GAAGTTTGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAAC
TATAGAGTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGG
GAAAACCCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGAT
GGAAAAATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCAC
TGTAACATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATC
TCAAACTCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCAT
GCGGATATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATA
TGAAAGTTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCC
GCGGTTCCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCC
ATGTATTCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGG
TGATGCAGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACA
CTTTCCGGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGG
TCAGGAGGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCT
GGACGGGACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTG
GATATGGTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAAC
AACTACACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGC
TGGACATGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATA
ACCTTACCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCA
GAGCCTCGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTT
AACTGGACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAA
CAGGTCCTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCC
TTGTCTAGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTAC
AGGAAACCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACC
ATCTCAGGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAA
GTGGAGAGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACAT
TGAAACTCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTG
TACAGTTGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGT
GGTTCATCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGA
GAACCCAAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCG
CCTGGGTTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAG
ATCCAGGTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAG
GTTGTCTGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGC
GGGAAGGCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTC
TCATTGGTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGA
GTGCAAGGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAA
ATCTGACAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCT
ACAACAACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGA
GGTTGTGACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTT
CCATTCGCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTAC
ATCAATGTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGT
ATCAAGGCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAG
GTTCCTCCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAG
TCCATGGTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGG
CAGGGATGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAG
GGCGAATTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTA
ACTGCCAAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGG
AGGGAGTATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGG
ATGTGTCAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGA
GGGGGGGCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCAT
AGGCCAGTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCG
GCACCGTGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTG
GATGCCACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCA
ACCACTCACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCAC
GAGATCCTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACA
TCCACAATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAG
AAACATACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTC
ACGTCTATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGG
GAACATCTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAA
AATGCACATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCC
CCATGGACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAA
CTGCGGGCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTG
TGAAAACATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGA
TTGACCTTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAA
ATTCGTAACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGT
CATGAAGGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGA
CCAACTTGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCC
ATCAATGTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGG
CCTTACACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCG
GAGCAGCATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTC
CTCCCCCAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGG
GGGAAGTCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCC
TAAGTGCAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGT
GGAGGAAGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGAT
ACAGGTGAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGG
CTCTATACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGA
GGGGAGGGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGA
ACAGCATTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACC
AACCATCCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGAT
CACATCCTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCT
GTCTGTGGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATG
TCCGAGACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGA
GAATCCATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGT
CAATGTCTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGC
AGGACACCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGT
GTCATAGCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGC
CGGGGGAGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCA
CCTCAACAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGAC
ACCCCTGACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTA
TCACCTGCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATG
AACCTAGAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGC
CGAGGATGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGG
ACACGACTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTG
CAGTCCTGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTC
ACCTCCACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGG
AGACCGGACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCC
ATCGTCCTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGG
TATTTAGGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCT
GGCAGGTGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCT
TCCTGTGGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCAC
TACAGCTTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTAC
CACTGATCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCT
TTGTGGAAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCT
GAAAACATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGG
GTACCACCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATG
GAGAGGTAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGA
GCTGGACATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGG
AGCAGGGTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTG
CTGGAGGACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACT
GGTGGGGGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGG
AGAGGTTACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTG
GAAGTGGAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGT
CGCATTGCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGG
AGGGGGAGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAA
CAGCAACAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAA
ACTCTGGCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGT
GTACACACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGG
ACAAGTTCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGC
CGCACCTGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTAC
CCATGACTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTG
CTATTCTTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTAC
ATGATTGGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGAT
GGACCTCCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACA
GTGGTGCTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGC
ATCTGGTTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCA
CAATGGCCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAG
CAAGTTACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATC
AATGCCATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAA
CGCAACCGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGA
TATATGCAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGAT
GGAACTGGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATAT
TGGCATTGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGG
GTACTAGCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGG
CACCTCTATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGC
AGGGGGACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCC
AGATCGACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCAT
GGCGGCGGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTG
CGGGCGTGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGG
GGACGGGTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAG
AATATAACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTA
CAAAGGCAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGA
CAGTATTTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGAC
AACAACAACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGA
CCTCTCTCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGC
ACTTCTTTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATA
TATGGCAATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGC
AACCCTCCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACG
TTGGACCAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCC
TTCAACTCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACAC
TGAGCTGAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTC
ATGACTTAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGT
TCAACAAATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTAC
AGTCAAGGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTG
AGCAGTACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACT
GTGTACAGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGA
TGGAGGACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTC
CAGCCCCAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGT
GGCATCGGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAG
GAGGAACCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTG
GTGGAGCAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAA
GTGAAGAGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGA
CTTGTCTTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCA
GCATTCTCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATT
CAGGCCCTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGG
TGGACGCATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACG
CAGGGACCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCT
GGAGCCTCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAAC
TCTACGTGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTA
ACATTGGGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCA
AGTTACACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTA
CCGGTGTTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCAT
ACCTTTTTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCA
GATAGCAGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGT
CAACACCATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGG
TTGAAACAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTA
CTGCCCAGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAG
ACGTGAGGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCC
ATGGCAGCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGC
CAGAACTTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGAC
ATGGATTGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTAC
ATCTGCTTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACC
ACTCCAGTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTG
GCTACATGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTG
ATGTGCCAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCC
AGCAGAGCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCG
AGGCATAGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATA
CTAATGGCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCC
CTACATGTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCA
CATCGGCATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTC
ATCTTGTGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCC
ATTTACTCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAA
GGAGACCAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTT
ATGGAAACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGT
CGTGGTAAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCA
ACCTGTAGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAAT
TGTATTATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTT
GGTGGGCGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCAT
CGATGGGAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACA
GCCTAGCAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAA
CTGGATGGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTC
TGGTGGAGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAAC
TACAAAAGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTAT
GAAGTGGGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCA
AGAAGCCCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACC
CCCACGCAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGG
TCATATGAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAA
CTCACACAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATG
TGGCCATCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGC
AGGTTGCTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGAC
TTTTGGATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCT
ACAGGTATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTT
TGGATGGAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGA
GTCGGGTGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAAC
CCAGTGGTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAA
ATGGAGATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAAC
ATCACTTGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAAC
TCACAGCTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGAT
ATGTCAGGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAG
TTACGGGGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTT
CCCGCTCCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTAT
TCACCACGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGC
AGGAGGACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCC
GGGTGGAAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGA
GGAGGAGGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGG
GACCGGCTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATG
GTGGTGCTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTAC
ACCTATGATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACA
TGCTGGCGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTA
CCCATCGCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCT
CGTGTCCAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGG
ACACATAGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTC
CTGCATACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCT
AGGATTCAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAA
CCCCACCATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCA
GGATATTCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAG
AGTGAATACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAAC
TCTTGGATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGT
TGGGCAGGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCA
TCTGGTGATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCC
AAACATTGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGG
TTGTTGCAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAG
GTACGTGGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTC
TGTAGACAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAG
GCCAGATGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTG
GTCGTGCATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAA
GGATGTGGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGA
CAGTTGGATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACA
ACAGAGCTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGT
GACTCGGAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTC
GCAGTGGAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAAT
GTTACAGTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAG
GCAGGAGGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCT
CCGGGGCAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATG
GTTGGCATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGA
TGGGGGGCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAA
TTTTGGTGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCC
AAGGGCGGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAG
TATCTGGATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGT
CAGGAGGAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGG
GCAGGGGGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCA
GTTCCTTGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCG
TGTACCTCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCC
ACAAGTGAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACT
CACAAACCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATC
CTCATAGAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACA
ATCGCATGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACAT
ACCTACCCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCT
ATGGTGGAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACAT
CTCCAGATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCA
CATTGGCTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGG
ACCTAACCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGG
GCAGCAGGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAA
CATCACAGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACC
TTGATGGACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGT
AACCATGGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAA
GGGAACATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACT
TGCATCTACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAAT
GTGGACGGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTAC
ACATGCCAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAG
CATCTGCCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCC
CAGGAGTTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAG
TCTGTTCGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTG
CAAGTGGACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGA
AGTCTTCAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGT
GAATGGAGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTAT
ACTTTGAATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAG
GGGCAGGCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCA
TTCAGTGGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCAT
CCCGGAGAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATC
CTTGATGTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGT
GGATGAAGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAG
ACCTGGCAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCC
ATCAATATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGT
CTATGCGAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACA
CCACACTTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATA
GCAACCAATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGG
AGGGGCTGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAA
CAGGCTTCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCT
GACTCAGAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCT
GCATCATGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTA
GAAAAAAGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGA
TGGATCCTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGA
CTACCACTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCC
TGTCACCAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCC
ACAATGCCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCG
GACAGGTGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTC
CTGAAATAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTA
GGACTAGCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGG
TGTTCTTGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGT
GGCTCCAACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGC
TTCCAGTTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGA
TCCTATCGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGG
AAGGGGGTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAAC
ATAACCGTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCA
CCCTGTACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGG
TAAACCTTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGA
CATGGAGGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGG
GTTTGCCTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAG
GACATGGACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGG
GGAGTGATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGT
TACTGCAAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTG
GAGGCAGCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATT
GCTGCCAATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGG
AGGGGGTGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAA
CAGGATTCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTG
GCTGAAAATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACAC
ACACCGAACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGT
TCCACATCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACC
TGGATCTTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGA
CTATCACTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTC
TTACCCACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATT
GGTGATCGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCT
CCATCGACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTG
CTTATCTTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGG
TTACATGGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGG
CCTCATGTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTT
ACTACAACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCC
ATTACATCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAAC
CGTCATTGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATG
CAGAAAACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACT
GGATTTGCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCAT
TGGGCAGACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTA
GCGGCCGTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTC
TATGAACCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGG
ACGTGGCGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCG
ACGGTGAGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGC
GGAGGCAGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCG
TGGCAATATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGG
GTGGCGGAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATA
ACCTACATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGG
CAGCCTTACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTAT
TTCTGTACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAAC
AACCTGAGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTC
TCAGGATTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCT
TTGCTGCAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGC
AATTCACACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCT
CCACTTTCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGAC
CAAACCAAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAAC
TCATTTGTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCT
GAACTCTGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACT
TAGTTCTAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACA
AATCAGATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAA
GGCCAGGTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGT
ACAACTTGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTAC
AGTAAGAACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGG
ACTGGTGGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCC
CAGGAACCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATC
GGGGGACGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAA
CCTACCGTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAG
CAGGAGACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAG
AGGATGCTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTC
TTCCTCCTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTC
TCATCACTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCC
CTTGGTGGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACG
CATCGCAGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGA
CCTTCGATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCC
TCTGGAACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACG
TGTGGACAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTG
GGGAACGTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTAC
ACATCACGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTG
TTGTTATCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTT
TTGATCAAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGC
AGTTCTGCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACAC
CATTCGTGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAA
CAGAGAACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCC
AGCAGTACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGA
GGCTCAAACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCA
GCAATCTTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAAC
TTACATGACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGAT
TGAGCCAGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGC
TTGGAGATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCA
GTAAACATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACA
TGTTGGGTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGC
CAATTAACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGA
GCCTTCTTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCAT
AGACGACCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATG
GCAGCATCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACAT
GTTCAAGATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGG
CATGGACATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTG
TGTCAAATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTAC
TCTGGTGGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGAC
CAGAGGATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAA
ACTCTGCAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGT
AAAGGTCAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGT
AGACTACGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATT
ATGGAGACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGG
CGAGGTGGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGG
GAGGATCACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAG
CAGGTGGTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGAT
GGGTACGGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGG
AGCAGGAGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAA
AGTTTAACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTG
GGTGGTTCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGC
CCAGCATAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACG
CAGCAACATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATAT
GAGAACATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACA
CAGCTATGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCA
TCCTGAGCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTG
CTAGGAGACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGG
ATTTGATGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGT
ATGGCCATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATG
GAAGTCAATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGG
TGGAGAACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTG
GTTCGTATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAG
ATGCTCTCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACT
TGTGGTTAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAG
CTGTGAATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCA
GGCCACTCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGG
GGGATCACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCT
CCTATCGTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCA
CGTCTCCCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGG
ACGAGGAGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGG
AAGGGCGTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGA
GGGGCAGGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGG
CTCTGTGGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTG
CTGGATCGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTAT
GATGGGGAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGG
CGGTGGCACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATC
GCACACTGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTC
CAGGAAGTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACAT
AGAATTTGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCAT
ACCATACTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATT
CAAGCCCCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCAC
CATCACACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATAT
TCCCAATGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAA
TACCAAGGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGG
ATGTGGGACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCA
GGGATGTTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGT
GATGCCACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACAT
TGCCTCACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTG
CAGAAGAAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGT
GGTGGTGGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGA
CAGAGTGACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGA
TGTTCCATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTG
CATCGCGGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGT
GGACATCTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTG
GATCAGGATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAG
CTGGATCATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCG
GAATGAAGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTG
GAGGGATGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACA
GTTGAATCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGA
GGCCTCTGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGG
CAGGGCATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGC
ATCACACATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGG
GCACAAGGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGG
TGAACATCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGC
GGGAAGTGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTG
GATCGAGACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAG
GAGATGGGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGG
GGACGAACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCT
TGCTACCGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACC
TCCATCGTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGT
GAGGAAGCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAA
CCGAACACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATA
GAAACTTGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCA
TGGATCCTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTAC
CCATTACTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTG
GAGCACATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAG
ATCAGACTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGG
CTTTAACCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAA
CCATCTATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCA
GGTGTCACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCAC
AGTTGTAGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATG
GACATCCAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCAT
GGAACCTTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAAC
ATTTGTACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATC
TACTTGCTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGAC
GGGAGTGGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGC
CAACCGTGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTG
CCTCCCAGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAG
TTCGGCAGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTT
CGTCAACGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTG
GACAGGACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTT
CAGCTCACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGG
AGGCAGTGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTG
AATTGATGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAG
GCTGAGCATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGT
GGAGAAAACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGA
GAACTTGGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGAT
GTCCTGGACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGA
AGGAGGTCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGG
CAGGCGATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAAT
ATCAGCTTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGC
GAACGGTACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACAC
TTACCCTGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACC
AATGGTGGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGC
TGGAGGACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCT
TCTCTTACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCA
GAGTGTGAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCA
TGAACATAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAA
AGGCCATTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATC
CTGCCCGACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCA
CTTTGAGGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCAC
CAACACACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATG
CCATACAATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGG
TGCAGTACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAA
TAGACCTCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTA
GCACCTGTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCT
TGCTCATATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCC
AACACGGAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAG
TTTGTGAGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTAT
CGTCGACCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGG
GTGGTATCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACC
GTGGACTCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGT
ACACAGTAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACC
TTGGGATTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGA
GGGAGTGGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGC
CTACGGAGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATG
GACTGATCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTG
ATCTGGATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGC
AAACGGTGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCA
GCATCTGGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCC
AATGGAGGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGG
TGGTGGCCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGAT
TCAACTACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAA
AATGGTGGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCG
AACACTCATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACA
TCATTCCTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATC
TTGCCACAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCA
CTTTGAGGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCC
ACCCGGTCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGAT
CGGTCTGGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCG
ACCAGAGATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATC
TTGGCCTTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACAT
GGAGTACTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCAT
GTCTCTGGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACA
ACTTTGACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACA
TCAACAACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCAT
TGAAGGTGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAA
ACATAACGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTT
GCCTACTCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCA
GACCAGTCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCC
GTGGTGTTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAA
CCATTCCTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGG
CGGAGGAGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTG
AGGTCAGAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGC
AGTGGAGGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAA
TATCACTGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCG
GAGGGTCGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTAC
ATTGGAACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCT
TACAGCTGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGT
ACCACCTGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTG
AGGAGCAAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGA
TTCGTTCAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTG
CAGGGAACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCA
CACCTAGCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTT
TCTCCACATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACC
AAGTCATGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTT
GTCTACCAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTC
TGTATTTGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTC
TAATCAATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAG
ATGTCTAGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAG
GTGTGCTATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACT
TGACTGCAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAG
AACATGAAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGT
GGATGCCAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAA
CCCAACATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGA
CGTGGAGGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACC
GTATGGCAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAG
ACAGAGGAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATG
CTGAAAGTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTC
CTCAAGTCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCA
CTACTGGTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGT
GGTGCAGGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGC
AGTCTACTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCG
ATGTCTATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGA
ACTGTTTTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGA
CAACAATGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAAC
GTTTGGATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCA
CGCGGTGGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTA
TCCTCACTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATC
AAACTTTCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCT
GCGGTGTTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCG
TGTCTTCATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGA
ACAACACCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGT
ACCTGTCGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCA
AACTGTAAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATC
TTGCTTCTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACAT
GACAGGTACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCC
AGGGTCTGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAG
ATGCAGAGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAAC
ATGCAGATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGG
GTACGAGCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTA
ACACTTACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTC
TTTTACCAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGA
CCTGTATGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCA
TCGGTGTAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAA
GATGGTGGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGA
CATCCAACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAA
ATGATCGGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGT
GGGAGGATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGG
ATCTGGTTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTG
CAGGAGGAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGT
CAAGCCAATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTA
CGGAAGTACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAG
ACAATGAGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGT
GGAGGGGCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGAT
CACTGCAAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTG
GTGGCTCGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTAC
GGAGCTGTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGG
AGGTGCAGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTA
ACGGCACAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGT
TCAGGCACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCA
TAAGAGCCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAA
CATACCAGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAAC
ATCAGCCAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTA
TGTTTTTGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGA
GCAACACGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGA
GACCGTACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGA
TGATGTTGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCC
ATCTTGAGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTC
AATGGCACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGA
ACTTCATTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGT
ATGAGTGTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTC
TCGGTGAAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGT
TAATGCAGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGA
ATGCAACCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCAC
TCAGCAGAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATC
ACATCGTGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATC
GTGGGATATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTC
CCTGGCAGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGG
AGGAGGAGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGC
GTCTCCATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCA
GGAGGGAGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGT
GGAAGTAACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGAT
CGGGTGGGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGG
GAGTACAAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGG
CACTGTTTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACAC
TGCGAGTCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAA
GTACAGCAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATT
TGTGTCTTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATA
CTGGTACTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCC
CCCTCCTCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCAC
ACTCACCTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAA
TGTGCATAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAA
GGACAGATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGG
GACACAGCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATG
TTCAAAAGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCC
ACCATGGATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTC
ACAGCTCCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAG
AAGAATCATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGT
GGTGGAGTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGT
GACAGGTGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCC
ATAACAGGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGC
GGAGCAAACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACAT
CTATATCCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAG
GATGCAAGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGAT
CATGTGGTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGA
AGTAACTACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGA
TGGTGCGGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAA
TCTTCTGCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTC
TGGTGATGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGC
ATGGTGGGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACA
CATGGATCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAA
GGTCTTCCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACA
TCTCCAATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAG
TGGGGCTCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGA
GACCCACATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATG
GGTACATGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGA
ACAGCAGTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTAC
CGGTGGGGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATC
GTCTGCAACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAA
GCACAAGTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAAC
ACTCTACATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACT
TGTCCTCCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATC
CTACCAGAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTA
CTTTCTTGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCAC
ATCTTGGCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGA
CTGGGATCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAA
CCAGACTTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCT
ATCCTGGAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTC
ACCGTAGATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGT
AGATGGAGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATC
CAACTGAGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACC
TTGCAGACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGT
ACAGGTGCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTG
CTGAAGTCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGT
GGACATTCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCG
TGGAACAGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCC
AGGAGACAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGC
AGTGGAGGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAA
CGCCACAGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGG
ACTCGCCAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTC
ACAGCAAGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAG
TGGTTATGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGA
TGGACTTTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAG
CATGGTGCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAA
AACTACCCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTT
GGATTCCCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTG
GACATCGGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGG
TCTGCCGGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCG
ATCACACAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGC
TTGAATGCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGG
TACAGTGGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCC
TGATGAACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGT
GGAGCTGGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGG
ACGGATAGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTT
ACCAGTCACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGT
GAGGGTGGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACA
TAGGACCCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCA
TTGACTGGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCC
GACTCGGGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGA
GGAATTACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACAC
ACCAACAAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATAC
AATGTCTCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGT
ACACATAGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACC
TCCCCTTCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCT
GTCACAGAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCA
TATACAGAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACG
GAGGAAGGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTG
AGGGTACAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGA
CCCAGGAATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTA
TCATGCACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGAC
TCAGGCGGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAG
TAACGACACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGA
TTCCTGATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGT
GGAGGGAGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGG
AGACTTGTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGA
TCATCAATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGG
ATGAATGTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGG
TGGAGAGGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCT
GGATGTACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGA
GGCCGAGGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGG
CCGCGTGGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACT
ACCATGCAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGT
GGTGCTGGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACT
CATTATCGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTC
CTGACTATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCA
CAATCAGGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGA
GGAGTTGCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGG
TCGGCCTCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCT
GGAACAGTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGA
GATTGACTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCC
TTGCACCAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTA
CTGGACCACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCT
GGAACATGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTG
ACATTGTCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACA
ACCGAGGAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGG
TGGTGGGAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAA
CGATAGATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTAC
TCAGATTACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAG
TCCACAGGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTG
TTGGCACACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTC
CTCTTCGGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGG
AGCAATTTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCA
GAGCTAATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGA
GGAAGCATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCAC
TGCTAACGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGT
CGGGTGGCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGA
ACTTATCAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGC
TGAGCAGCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACC
TGCACCACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGC
AAGAATGTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTT
CAAAGCTTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGA
ACCACGACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTA
GCCATTCTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCA
CATGATTGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCA
TGGATCTGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTAC
CAGACAGGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATT
TGTCCATATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCA
ATGGAGGCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCT
AGGCTCAACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGC
TATCAATGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTG
CAGGGAAGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATG
AAGATCCTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGC
CAGTGATGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAAC
ATCGTCTTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGA
GGTTGTGGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGG
CAACCTCTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAG
GAGGCATCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAA
GTGGATGGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAG
TCTGAATGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTG
GTGCACTTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCA
GGAGACCCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTA
CTTCTCCAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCT
ATGGTGGAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTT
TTTCTGAAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAA
TGGAAGAGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGG
ATCTGTCACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGT
GGAGTGTCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCA
CTATAACCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTT
TCCATACTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTG
TTGACTTTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTT
CATCAACTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACA
CCATAACAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGT
CGCCAGGGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGT
AAAACTGTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTT
CTCTGTCGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGG
TACCGCTATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTC
TGGGACCAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAG
AGCTGGCGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAG
ATCAACCGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGA
GCAGGACTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTT
ACGTCTATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTAC
CAGACTGTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTA
TGTGTTTGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTG
TAAACACTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGT
GGAACGTTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCA
ACTGACCAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATC
GGTTTAATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGG
ATCAACCTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGG
TTTCGAAACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAG
GAAGTGGAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCC
AATGTTGGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAG
TACAGGAGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATG
AGCATGGCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGG
GCACTGAAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGC
AAATGGAGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCT
CGGGTGGAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCT
GTCTCTGCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGC
AGGCGGACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCA
CAGTCACAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGC
ACCGTCTATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAG
CCTGAAGATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACC
AGCATGGTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGC
CAATCAGGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTT
TGATGAGCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACA
CGAGTACAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGT
ACAGGTGTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGT
TGACATCTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTG
AGTTATCTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGC
ACCATTGCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCA
TTTGTGGTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGT
GTGCCAACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTG
AAAAACGACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGC
AGGAGGCTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAA
CCATTGATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCA
GAGGAAGGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCG
TGGATCCGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGA
TATACTCGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGC
AGTGGGGGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGG
AGTTGTGCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCC
ATGCCAACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGG
AGCATCCTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGT
AACGGGTGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTG
GGCGCATTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTAC
AAGGTACACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGT
TTACATTGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAG
TCGACAACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAG
CAGATCTCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTC
TTATAGTGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTA
CTTCTCCTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCC
TCCAGCTCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCAC
CTTTCCATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCA
TAGACAGCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAG
ATCTATAACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACA
GCAGGAGGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAA
AGATCTATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATG
GATGCCATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCT
CCCTTTTACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAAT
CATCATACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGA
GTTAGCTTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGG
TGACTACACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACA
GGTTTTCTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCA
AACCTCACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATAT
CCGAGGCCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCA
AGTTTGTACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTG
GTGGTCAAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAAC
TACGACTTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGC
GGTCAAATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCT
GCCCATCTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGA
TGGTACAGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTG
GGAATGGTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGA
TCCTTCCTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTT
CCCTCATCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCA
ATGCCCTCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGC
TCAGTGGCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCA
CATCTTTGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACA
TGGGCCAGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCA
GTGTACTACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGG
GGATGGCTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGC
AACCTGACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAA
GTTACCCATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTA
CATCAACAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCT
CCCTCTACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCA
GAAGACTTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCT
TGAGGATGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTG
GCTTTTTATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGA
TCTCTGCATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGAC
TTTGTATGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTG
GAGGCCTGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTA
GATGTGCAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGG
AGGAATCATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTG
AGACTTTCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAG
ACATCAAATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGT
GCATGGAGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAG
TCATCATTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACAT
TCTGCTGGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAAC
AGGTGGGAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGA
CAGGACCCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGA
GGAGGGAACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCAC
AGACTTTGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGC
CAGGTGAATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCA
AGGAAACTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTA
TGGAGGTGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACT
TTGATGGAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGT
GCATCCGGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTAC
CCTGAGGATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTC
CCCTCCCCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATC
GGAGGGTATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCC
GGTCAGCGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACA
CAGGGACCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAAT
GCAACACACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGT
GGGACTTCCCCACAACACCTACCTGCAGGACACCACACTTACCCTGATGA
ACTGTCACCTCATCAAGGGCTCAGGTGTCATAGCAACCAATGGTGGAGCT
GGCTCAAGTCACAATAGCTATCCAGCCGGGGGAGGGGCTGGAGGACGGAT
AGCACTGTACTTCAGGGATAACGCCACCTCAACAGGCTTCTCTTACCAGT
CACATGGGGGGGCTTGTGGTGATGACACCCCTGACTCAGAGTGTGAGGGT
GGGGGGCCGGGAACCATTTTCTTGTATCACCTGCATCATGAACATAGGAC
CCTCATCGTTGAAAATGGTGGACATGAACCTAGAAAAAAGGCCATTGACT
GGGACAATCTTGACAAGGATGGCTGCCGAGGATGGATCCTGCCCGACTCG
GGGAGACACTACTTTGCCAGCTATGGACACGACTACCACTTTGAGGAATT
ACAAATAGATGAAGGCGCCCACCTTGCAGTCCTGTCACCAACACACCAAC
AAGCCTTGTACGATGAGAATGTCTTCACCTCCACAATGCCATACAATGTC
TCCATGTTCTTTCAATACATGATTGGAGACCGGACAGGTGCAGTACACAT
AGCAACAGGGCAAGAGGTGGAACTCCATCGTCCTGAAATAGACCTCCCCT
TCAGTGTCCACGTCTACTATGGAGGGTATTTAGGACTAGCACCTGTCACA
GAAGTCCATGGAGTGGAGATTCATCTGGCAGGTGTTCTTGCTCATATACA
GAACCTCACAATCCACCATGGAGGCTTCCTGTGGCTCCAACACGGAGGAA
GGACACTACTGGAGGACTTCAGCCACTACAGCTTCCAGTTTGTGAGGGTA
CAGGATGACGGAAGGCTAAATGCTACCACTGATCCTATCGTCGACCCAGG
AATTACTTTTATAACTCAGGCCTTCTTTGTGGAAGGGGGTGGTATCATGC
ACGGTACTCGACTCACGATACTCGCTGAAAACATAACCGTGGACTCAGGC
GGTAGGATTGCGGCAGATGGATTAGGGTACCACCCTGTACACAGTAACGA
CACCCACGGACACCTGTCCCTCCATGGAGAGGTAAACCTTGGGATTCCTG
ATGATGTCACTGGGCTAGGGTCAGGAGCTGGACATGGAGGGAGTGGAGGG
AGAGGGACTCTCAATGATGGTCATGGAGCAGGGTTTGCCTACGGAGACTT
GTATGAACCATACGTCTTCGGCAGTGCTGGAGGACATGGACTGATCATCA
ATGGCAAGCGGGCCTATGGTGGAACTGGTGGGGGAGTGATCTGGATGAAT
GTGACAGGGACAATTGATATTGATGGAGAGGTTACTGCAAACGGTGGAGA
GGCAGATGGAAATGGAGGTGGAGGTGGAAGTGGAGGCAGCATCTGGATGT
ACTGTAACATCATCAAAGGATATGGTCGCATTGCTGCCAATGGAGGCCGA
GGCTCGAACCACTCATCCTCACCCGGAGGGGGAGGGGGTGGTGGCCGCGT
GGCCATCTACTTCATCAACAACCAAACAGCAACAGGATTCAACTACCATG
CAAAGGGTGGGAGGGCAGGGGACCAAACTCTGGCTGAAAATGGTGGTGCT
GGAACAGCTTTTATCTACCACATGGTGTACACACACCGAACACTCATTAT
CGACAATGGAGGGTTAGAACCCAAGGACAAGTTCCACATCATTCCTGACT
ATACTGACGTGACAACCGACGGTTGCCGCACCTGGATCTTGCCACAATCA
GGCCAACACTTTTTTGCCAATGGTACCCATGACTATCACTTTGAGGAGTT
GCAAATCTACGGCTCTGCCCATCTTGCTATTCTTACCCACCCGGTCGGCC
TCAATGCAAGTCTGTTCTTCCTGTACATGATTGGTGATCGGTCTGGAACA
GTGCATCTTGGCATGAATCAAGTGATGGACCTCCATCGACCAGAGATTGA
CTTGCCGTTCAGCACACGTGTTTACAGTGGTGCTTATCTTGGCCTTGCAC
CAATCACAATGATCCACAATGTCAGCATCTGGTTACATGGAGTACTGGAC
CACGTGGAAGATCTTACACTGCATCACAATGGCCTCATGTCTCTGGAACA
TGGAGGGAGGACAGAGGGCATGGAAGCAAGTTACTACAACTTTGACATTG
TCCTTGTCCAAGACAATGGCACAATCAATGCCATTACATCAACAACCGAG
GAGCCAGGAATCACTTTTTACACCAACGCAACCGTCATTGAAGGTGGTGG
GAGGTTCCACGGCACACGCCTCAGGATATATGCAGAAAACATAACGATAG
ATGATGGCGGACTTCTAGATGCAGATGGAACTGGATTTGCCTACTCAGAT
TACAACAGGACTGCAGAGATCAATATTGGCATTGGGCAGACCAGTCCACA
GGGTTCCTCTGGAGGTTGCCATGGGGGTACTAGCGGCCGTGGTGTTGGCA
CACCTGTGACTGGGACTCCATATGGGCACCTCTATGAACCATTCCTCTTC
GGCAGTGCAGGTGGCGGTGAGAGAGCAGGGGGACGTGGCGGAGGAGCAAT
TTGGTTCAACGTCACGGGTGTGATCCAGATCGACGGTGAGGTCAGAGCTA
ATGGTGAGGATGCCCACGAACGTCATGGCGGCGGAGGCAGTGGAGGAAGC
ATTTGGATGAACTCCTACATCTTTTGCGGGCGTGGCAATATCACTGCTAA
CGGAGGGGCCCAGTACCACGACCAGGGGACGGGTGGCGGAGGGTCGGGTG
GCCGAATTGCTGTGTACTTTCGTGAGAATATAACCTACATTGGAACTTAT
CAGGCATTTGGGGGTTATGCAGAGTACAAAGGCAGCCTTACAGCTGAGCA
GCAGGGAGAACCCGGTGGACCAGGGACAGTATTTCTGTACCACCTGCACC
ACGAACATCGCACACTGCTGATTGACAACAACAACCTGAGGAGCAAGAAT
GTTGGCCCTATCGCCAACTATTCCGACCTCTCTCAGGATTCGTTCAAAGC
TTGGATCCTTCCCCAGGCTGGTGAGCACTTCTTTGCTGCAGGGAACCACG
ACTATCATTTCGAGGAGCTACAGATATATGGCAATTCACACCTAGCCATT
CTAACTGACCCTGTGGACAGAGGAGCAACCCTCCACTTTCTCCACATGAT
TGGAGACAGGACTGGAAGCATCCACGTTGGACCAAACCAAGTCATGGATC
TGGAACGGCATTTCATTGACACACCCTTCAACTCATTTGTCTACCAGACA
GGATATCTAGGACTTGCCCCTGACACTGAGCTGAACTCTGTATTTGTCCA
TATTGAGGGGACCATGGACCATGTTCATGACTTAGTTCTAATCAATGGAG
GCGAGCTGAGGTTTTTCCTGACAGGTTCAACAAATCAGATGTCTAGGCTC
AACTACCGCTTCAACGGCACTGTTACAGTCAAGGCCAGGTGTGCTATCAA
TGCCAGCAGCCCCTTTGCTCATCCTGAGCAGTACAACTTGACTGCAGGGA
AGTTGATTGTGGAGGGAGGTGGAACTGTGTACAGTAAGAACATGAAGATC
CTGGCAGAGGAGATGGAAGTAGATGATGGAGGACTGGTGGATGCCAGTGA
TGGAGGATATCTGTCTGAACTTGGTCCAGCCCCAGGAACCCAACATCGTC
TTGGCAACAGTGGTGGTAGTCATGGTGGCATCGGGGGACGTGGAGGTTGT
GGAGGGTACAAGACTTGTAGACTCAGGAGGAACCTACCGTATGGCAACCT
CTTCTACCCAGCTGAGTTCGGCAGTGGTGGAGCAGGAGACAGAGGAGGCA
TCGGTGGGGGCATCCTTGATATAGAAGTGAAGAGGATGCTGAAAGTGGAT
GGAGACATCACAGCAAACAGCAGAGACTTGTCTTCCTCCTCAAGTCTGAA
TGGTGCCAGTGGAGGCAGTGGTGGCAGCATTCTCATCACTACTGGTGCAC
TTACAGGTGGACATACTGGACACATTCAGGCCCTTGGTGGTGCAGGAGAC
CCTTCCAATGGTGGAAGTGGTGCAGGTGGACGCATCGCAGTCTACTTCTC
CAACAACATCACGCACGCATTTTACGCAGGGACCTTCGATGTCTATGGTG
GAGATGTTGGAGCTTTAGCCGAGTCTGGAGCCTCTGGAACTGTTTTTCTG
AAGAGCAAGGAGTCAGGGAACACAACTCTACGTGTGGACAACAATGGAAG
AGCATCCACAAATCACAAGATCTCTAACATTGGGGAACGTTTGGATCTGT
CACCAGAGACAATGAGCAGAGTTTCAAGTTACACATCACGCGGTGGAGTG
TCTGTCACGTCAACCTCTAATTCCTACCGGTGTTGTTATCCTCACTATAA
CCCCCCCGACTGGTACTGGCTGCCATACCTTTTTGATCAAACTTTCCATA
CTGATCAAACACAGTATTTCCTGGCAGATAGCAGTTCTGCGGTGTTGACT
TTTGACCTCAACAATGTCTACTTTGTCAACACCATTCGTGTCTTCATCAA
CTGCGCATGTCGGAGTAAATTCAAGGTTGAAACAGAGAACAACACCATAA
CAACTGCTGTGACCAGTGACTATGTACTGCCCAGCAGTACCTGTCGCCAG
GGCTCATATGTAAACCTACCTGTCAGACGTGAGGCTCAAACTGTAAAACT
GTATGTCACGGGGACATCGGCCTGCCATGGCAGCAATCTTGCTTCTCTGT
CGGAAGTTGAAATCTATGTCAATGGCCAGAACTTACATGACAGGTACCGC
TATAGAGAACTGGACAGTGCAAAGACATGGATTGAGCCAGGGTCTGGGAC
CAACCAGTACACATTTGACCAGTTACATCTGCTTGGAGATGCAGAGCTGG
CGGTGATGCCAGGGAACGGACTCACCACTCCAGTAAACATGCAGATCAAC
CGCCTACATGGAGACAAGACTGGCTGGCTACATGTTGGGTACGAGCAGGA
CTTTGCCGTTGATGTGACAGATCCTGATGTGCCAATTAACACTTACGTCT
ATGAGAAGGGAGAACTGGAGTACCCCAGCAGAGCCTTCTTTTACCAGACT
GTGCTTAGATCTTCTGGCAAGATCCGAGGCATAGACGACCTGTATGTGTT
TGATGGTGGGTCGGTGTACGTCGATACTAATGGCAGCATCGGTGTAAACA
CTCCTGGACATATCAGCCTGTCTTCCCTACATGTTCAAGATGGTGGAACG
TTCCAAATGTTCTCATATGACAAGCACATCGGCATGGACATCCAACTGAC
CAATCTAACGGTATATGGAGGCGGTCATCTTGTGTCAAATGATCGGTTTA
ATGTGACAGCAGAACATCTTGTGGCCATTTACTCTGGTGGGAGGATCAAC
CTTGACCATGGAGGCTTTTTCACCAAGGAGACCAGAGGATCTGGTTTCGA
AACCTCAGAAGGACCTGGTCAGGGTTATGGAAACTCTGCAGGAGGAAGTG
GAGGTGGCCATGGTGGCAGTGGAGGTCGTGGTAAAGGTCAAGCCAATGTT
GGGCTTGCCTATGGATCCATCTACCAACCTGTAGACTACGGAAGTACAGG
AGGATATGGCAGCGACTATGGACAATTGTATTATGGAGACAATGAGCATG
GCAATGCTGTTGTGCGGAGAGGACTTGGTGGGCGAGGTGGAGGGGCACTG
AAAATAACCACCAGACACTGCCTCATCGATGGGAGGATCACTGCAAATGG
AGAAAGCATTGATGGTGTTCATAACAGCCTAGCAGGTGGTGGCTCGGGTG
GAAGCATCTGGCTAGAGTGTGAAGAACTGGATGGGTACGGAGCTGTCTCT
GCCAACGGTGGAACTGGTCATGGCTCTGGTGGAGCAGGAGGTGCAGGCGG
ACGTGTGGCCATCTACTCCCAGAAACTACAAAAGTTTAACGGCACAGTCA
CAGCTTATGGAGGGAACAGCAACTATGAAGTGGGTGGTTCAGGCACCGTC
TATATTGAACACCAGAATGCCTTGCAAGAAGCCCAGCATAAGAGCCTGAA
GATCAACAACAATGGCATCCCTTACCCCCACGCAGCAACATACCAGCATG
GTGACCTTCGTGACCTGTTAGATGGGTCATATGAGAACATCAGCCAATCA
GGTGGCATCACCTGGCTTTACCACAACTCACACAGCTATGTTTTTGATGA
GCTGCACATCCACGGCAATGCCCATGTGGCCATCCTGAGCAACACGAGTA
CAGATGTGGTGGAAGTGCAGGGAGGCAGGTTGCTAGGAGACCGTACAGGT
GTGATGCATGTTGGGAAGAACCAGACTTTTGGATTTGATGATGTTGACAT
CTATCTACCAGTGAACACTCAGCTCTACAGGTATGGCCATCTTGAGTTAT
CTCAGCGTCTCAGCATGCGGGAAGTTTGGATGGAAGTCAATGGCACCATT
GCCAACATTGATGACTTAACTATAGAGTCGGGTGGAGAACTTCATTTGTG
GTCCTATGGCAACACCAGGGGAAAACCCAGTGGTTCGTATGAGTGTGCCA
ACATAAGTGTTCGGGCTGATGGAAAAATGGAGATGCTCTCGGTGAAAAAC
GACAGCAGAATAGACGTCACTGTAACATCACTTGTGGTTAATGCAGGAGG
CTACGTGAGGACAAATGATCTCAAACTCACAGCTGTGAATGCAACCATTG
ATGTAGCAGGTGATTTCCATGCGGATATGTCAGGCCACTCAGCAGAGGAA
GGCCCAGGAGCAGGGAGATATGAAAGTTACGGGGGATCACATCGTGGATC
CGGTGGTGGCCATGGAGGCCGCGGTTCCCGCTCCTATCGTGGGATATACT
CGGGGTTTGCCTATGACTCCATGTATTCACCACGTCTCCCTGGCAGTGGG
GGAGGGCACGGGGGCAGCGGTGATGCAGGAGGACGAGGAGGAGGAGTTGT
GCACTTAGATGTCATGGACACTTTCCGGGTGGAAGGGCGTCTCCATGCCA
ACGGAGAGTCTGGGACCAGGTCAGGAGGAGGAGGGGCAGGAGGGAGCATC
CTTCTCACCGTGGGACACCTGGACGGGACCGGCTCTGTGGAAGTAACGGG
TGGTTCTGCACCAGGCCCTGGATATGGTGGTGCTGGATCGGGTGGGCGCA
TTGCTGTTTACTACAGGAACAACTACACCTATGATGGGGAGTACAAGGTA
CACGGAGGTCAGGACAAAGCTGGACATGCTGGCGGTGGCACTGTTTACAT
TGAGGGTATCAACCACAATAACCTTACCCATCGCACACTGCGAGTCGACA
ACAACCAAGGGTCATCCCCAGAGCCTCGTGTCCAGGAAGTACAGCAGATC
TCTCTAGCCGGACCTACGTTAACTGGACACATAGAATTTGTGTCTTATAG
TGGAGTTACTGTCCAAACAACAGGTCCTGCATACCATACTGGTACTTCTC
CTAATGTCTATTGGCACTCCTTGTCTAGGATTCAAGCCCCCTCCTCCAGC
TCTTACTACAGAAGCACTACAGGAAACCCCACCATCACACTCACCTTTCC
ATTTACCTTGTACATCGACCATCTCAGGATATTCCCAATGTGCATAGACA
GCCTGACAACAGCCTTCAAAGTGGAGAGTGAATACCAAGGACAGATCTAT
AACCACACAGACGGTTACATTGAAACTCTTGGATGTGGGACACAGCAGGA
GGTTGACCAGTATGCTGTTGTACAGTTGGGCAGGGATGTTCAAAAGATCT
ATGTAAAGCTTGATGCCCGTGGTTCATCTGGTGATGCCACCATGGATGCC
ATTCAGCTGTTTGCACGAGAGAACCCAAACATTGCCTCACAGCTCCCTTT
TACCTCAGCACCTGGCAGCGCCTGGGTTGTTGCAGAAGAAGAATCATCAT
ACCATTTTGAATTTGATGAGATCCAGGTACGTGGTGGTGGTGGAGTTAGC
TTTGAAGGAGAAGGCAGCAGGTTGTCTGTAGACAGAGTGACAGGTGACTA
CACCGGCCTGGTGACCATGCGGGAAGGCCAGATGTTCCATAACAGGTTTT
CTAGAGACATCCTGCCATTCTCATTGGTCGTGCATCGCGGAGCAAACCTC
ACACTTCCGCCACGTACAGAGTGCAAGGATGTGGACATCTATATCCGAGG
CCACTTTGACACCATACAAAATCTGACAGTTGGATCAGGATGCAAGTTTG
TACTTGATCACCTGGATCCTACAACAACAGAGCTGGATCATGTGGTGGTC
AAAACCTTTGGAGAAATGGAGGTTGTGACTCGGAATGAAGTAACTACGAC
TTTGACTGGACAGACATTTTCCATTCGCAGTGGAGGGATGGTGCGGTCAA
ATGACCTTGAACTGCACTACATCAATGTTACAGTTGAATCTTCTGCCCAT
CTAACTGTGGATGAAGGTGTATCAAGGCAGGAGGCCTCTGGTGATGGTAC
AGGAGTTGGCAGTCCGTCAGGTTCCTCCGGGGCAGGGCATGGTGGGAATG
GTGGTCAGGGTTATTCCCAGTCCATGGTTGGCATCACACATGGATCCTTC
CTTATCCCAAACACGTTTGGCAGGGATGGGGGGCACAAGGTCTTCCCTCA
TCTTGGTGGGAGAGGTGGAGGGCGAATTTTGGTGAACATCTCCAATGCCC
TCGTTGTGGACGGCTTTCTAACTGCCAAGGGCGGGAAGTGGGGCTCAGTG
GCAGCAGGAGGTGGAAGTGGAGGGAGTATCTGGATCGAGACCCACATCTT
TGATGGAGACGGAGTGGTGGATGTGTCAGGAGGAGATGGGTACATGGGCC
AGGAGTCCACTGCAGGAGGAGGGGGGGCAGGGGGACGAACAGCAGTGTAC
TACACACACAACCACTTCATAGGCCAGTTCCTTGCTACCGGTGGGGATGG
CTCTGAACCAGGTGGTCCCGGCACCGTGTACCTCCATCGTCTGCAACCTG
ACAACCAGACACAACTTCTGGATGCCACAAGTGAGGAAGCACAAGTTACC
CATGATTCCAACGTCACCCAACCACTCACAAACCGAACACTCTACATCAA
CAACTTAGGGAAGAGACCACGAGATCCTCATAGAAACTTGTCCTCCCTCT
ACACCAGTTATGCTTCCACATCCACAATCGCATGGATCCTACCAGAAGAC
TTGTCAGAGATAGCTGATAGAAACATACCTACCCATTACTTTCTTGAGGA
TGTCATCATTGATGAGCTTCACGTCTATGGTGGAGCACATCTTGGCTTTT
TATGGCCGGTCGGCCCAAGGGAACATCTCCAGATCAGACTGGGATCTCTG
CATGGGGACCGCACTGGGAAAATGCACATTGGCTTTAACCAGACTTTGTA
TGCTGCCAATGCTCATCTCCCCATGGACCTAACCATCTATCCTGGAGGCC
TGGCGACCACGCATGGAGAACTGCGGGCAGCAGGTGTCACCGTAGATGTG
CAGGGAGTGGTGGCCAACTGTGAAAACATCACAGTTGTAGATGGAGGAAT
CATAAAAATGCATGAGATGATTGACCTTGATGGACATCCAACTGAGACTT
TCAACTTCAATGCCATCAAAATTCGTAACCATGGAACCTTGCAGACATCA
AATGGACAGAACCAACGTGTCATGAAGGGAACATTTGTACAGGTGCATGG
AGGTGGAGTTATCACATCGACCAACTTGCATCTACTTGCTGAAGTCATCA
TTGTGGATGTCAAAGGATCCATCAATGTGGACGGGAGTGGACATTCTGCT
GGAGTTGGTCCAGGTGCAGGCCTTACACATGCCAACCGTGGAACAGGTGG
GAGCCATGGTGGGAGTGGCGGAGCAGCATCTGCCTCCCAGGAGACAGGAC
CCGCCTACGGCTCCTTCCTCCTCCCCCAGGAGTTCGGCAGTGGAGGAGGG
AACAGTGGAGGTGCTGGCGGGGGAAGTCTGTTCGTCAACGCCACAGACTT
TGTTCGTATTGAAGGTGTCCTAAGTGCAAGTGGACAGGACTCGCCAGGTG
AATATGGAGGAGGAGGCAGTGGAGGAAGTCTTCAGCTCACAGCAAGGAAA
CTGGAAGGGACTGGGAAGATACAGGTGAATGGAGGCAGTGGTTATGGAGG
TGGAGGTGGCGGAAGGATGGCTCTATACTTTGAATTGATGGACTTTGATG
GAAGCCTGGAATCCTCAGGAGGGGAGGGGCAGGCTGAGCATGGTGCATCC
GGGACAGTCTTCTTCAAAGAACAGCATTCAGTGGAGAAAACTACCCTGAG
GATATACAATGGCTATAACCAACCATCCCGGAGAACTTGGATTCCCCTCC
CCGAAGACCAAGCTGATGATCACATCCTTGATGTCCTGGACATCGGAGGG
TATGCACATGTCGGCCTGCTGTCTGTGGATGAAGGAGGTCTGCCGGTCAG
CGACAGCAGGACGTTACATGTCCGAGACCTGGCAGGCGATCACACAGGGA
CCGTCCATGTTGACCGTGGAGAATCCATCAATATCAGCTTGAATGCAACA
CACAAGATTCCCTTCAACGTCAATGTCTATGCGAACGGTACAGTGGGACT
TCCCCACAACACCTACCTGCAGGACACCACACTTACCCTG
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96890gene:BL96890Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96890_cuf5transcript:BL96890_cuf5-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96890_cuf5-E1BL96890_cuf5-E1-1564476830-222555Branchiostoma lanceolatumexon
BL96890_cuf5-E2BL96890_cuf5-E2-1564476830-222557Branchiostoma lanceolatumexon
BL96890_cuf5-E3BL96890_cuf5-E3-1564476830-222559Branchiostoma lanceolatumexon
BL96890_cuf5-E4BL96890_cuf5-E4-1564476830-222562Branchiostoma lanceolatumexon
BL96890_cuf5-E5BL96890_cuf5-E5-1564476830-222564Branchiostoma lanceolatumexon
BL96890_cuf5-E6BL96890_cuf5-E6-1564476830-222566Branchiostoma lanceolatumexon
BL96890_cuf5-E7BL96890_cuf5-E7-1564476830-222568Branchiostoma lanceolatumexon
BL96890_cuf5-E8BL96890_cuf5-E8-1564476830-222570Branchiostoma lanceolatumexon
BL96890_cuf5-E9BL96890_cuf5-E9-1564476830-222572Branchiostoma lanceolatumexon
BL96890_cuf5-E10BL96890_cuf5-E10-1564476830-222574Branchiostoma lanceolatumexon
BL96890_cuf5-E11BL96890_cuf5-E11-1564476830-222576Branchiostoma lanceolatumexon
BL96890_cuf5-E12BL96890_cuf5-E12-1564476830-222578Branchiostoma lanceolatumexon
BL96890_cuf5-E13BL96890_cuf5-E13-1564476830-222580Branchiostoma lanceolatumexon
BL96890_cuf5-E14BL96890_cuf5-E14-1564476830-222582Branchiostoma lanceolatumexon
BL96890_cuf5-E15BL96890_cuf5-E15-1564476830-222584Branchiostoma lanceolatumexon
BL96890_cuf5-E16BL96890_cuf5-E16-1564476830-222586Branchiostoma lanceolatumexon
BL96890_cuf5-E17BL96890_cuf5-E17-1564476830-222588Branchiostoma lanceolatumexon
BL96890_cuf5-E18BL96890_cuf5-E18-1564476830-222590Branchiostoma lanceolatumexon
BL96890_cuf5-E19BL96890_cuf5-E19-1564476830-222592Branchiostoma lanceolatumexon
BL96890_cuf5-E20BL96890_cuf5-E20-1564476830-222594Branchiostoma lanceolatumexon
BL96890_cuf5-E21BL96890_cuf5-E21-1564476830-222596Branchiostoma lanceolatumexon
BL96890_cuf5-E22BL96890_cuf5-E22-1564476830-222598Branchiostoma lanceolatumexon
BL96890_cuf5-E23BL96890_cuf5-E23-1564476830-222600Branchiostoma lanceolatumexon
BL96890_cuf5-E24BL96890_cuf5-E24-1564476830-222602Branchiostoma lanceolatumexon
BL96890_cuf5-E25BL96890_cuf5-E25-1564476830-222604Branchiostoma lanceolatumexon
BL96890_cuf5-E26BL96890_cuf5-E26-1564476830-222606Branchiostoma lanceolatumexon
BL96890_cuf5-E27BL96890_cuf5-E27-1564476830-222608Branchiostoma lanceolatumexon
BL96890_cuf5-E28BL96890_cuf5-E28-1564476830-222610Branchiostoma lanceolatumexon
BL96890_cuf5-E29BL96890_cuf5-E29-1564476830-222612Branchiostoma lanceolatumexon
BL96890_cuf5-E30BL96890_cuf5-E30-1564476830-222614Branchiostoma lanceolatumexon
BL96890_cuf5-E31BL96890_cuf5-E31-1564476830-222616Branchiostoma lanceolatumexon
BL96890_cuf5-E32BL96890_cuf5-E32-1564476830-222618Branchiostoma lanceolatumexon
BL96890_cuf5-E33BL96890_cuf5-E33-1564476830-222620Branchiostoma lanceolatumexon
BL96890_cuf5-E34BL96890_cuf5-E34-1564476830-222622Branchiostoma lanceolatumexon
BL96890_cuf5-E35BL96890_cuf5-E35-1564476830-222624Branchiostoma lanceolatumexon
BL96890_cuf5-E36BL96890_cuf5-E36-1564476830-222626Branchiostoma lanceolatumexon
BL96890_cuf5-E37BL96890_cuf5-E37-1564476830-222628Branchiostoma lanceolatumexon
BL96890_cuf5-E38BL96890_cuf5-E38-1564476830-222631Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000048genomeSc0000048:1895029..1926373 +
Properties
Property NameValue
Transcript idBL96890_cuf5
Biotypeprotein_coding