Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

transcript:BL96885_cuf1 (mRNA) - B. lanceolatum

Overview
Nametranscript:BL96885_cuf1
Unique Nametranscript:BL96885_cuf1
TypemRNA
OrganismBranchiostoma lanceolatum (Amphioxus)



Sequence
The following sequences are available for this feature:

protein sequence of transcript:BL96885_cuf1

>transcript:BL96885_cuf1-protein ID=transcript:BL96885_cuf1-protein|Name=transcript:BL96885_cuf1|organism=Branchiostoma lanceolatum|type=polypeptide|length=215bp
ANIPPVFNVTSEIRATVGQEYGLQLEATDDGSVTITVAQGPGSLNGSNYY
TWTPSDTSNYTIQFLATDDVGASTSQTPDITVCACQNNGTCNFDTTLTAR
SFGFAISTCNCQLGFVGDYCETDYNGCSVTPCYPGVNCTDAVAPLSHGAK
EYTCGSCPAGMVGDGESCVDLDECLLASNDANVHQCKNATCFNEAPGYRC
ECLSGYSMMADNRTC
Run BLAST on NCBI

mRNA from alignment at Sc0000241:12073..13335-

Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>transcript:BL96885_cuf1 ID=transcript:BL96885_cuf1|Name=transcript:BL96885_cuf1|organism=Branchiostoma lanceolatum|type=mRNA|length=1263bp|location=Sequence derived from alignment at Sc0000241:12073..13335- (Branchiostoma lanceolatum)
AGCGAACATCCCGCCGGTCTTCAATGTGACGTCAGAGATCCGGGCTACCG TTGGTCAGGAGTACGGGCTGCAGCTGGAGGCTACAGACGACGGTTCGGTC ACCATCACCGTCGCGCAGGGGCCGGGAAGTCTCAACGGCAGTAACTACTA CACGTGAGTCATGCTCTTTTTTTGTCTTTTTATATGCGAAGACATGCAAT ATGTAGAAACTGTAAAACATCATATCAGATTATTGTAATGAGGAAGACTC TGTAGAAGCGAGTTCTGTCAACGTGCATTTTTCATGTATGACTATGAAGC AGATTATTGAAACAGAATTTCAATACCCATTGAAAGATCAGGACGTTTAA GAGCTATCTATCACATTGACACAGGTGGACGCCTTCCGACACGTCTAACT ACACTATCCAGTTTCTGGCCACGGATGACGTCGGTGCCTCCACATCTCAG ACCCCCGACATCACGGTGTGCGCATGTCAAAACAATGGTACCTGCAATTT CGATACCACCCTGACGGCACGTAGCTTTGGGTTCGCCATCTCCACATGCA ACTGTCAGCTCGGCTTCGTCGGCGACTACTGTGAGACGGACTACAACGGC TGCTCTGTCACACCTTGCTATCCAGGTAGGTCGACTATACAGGTTGCACT TTTTGTTCAATACTTCATTCTTTTTAATCCCTCCAATACAGCCTCTTTGG CACTTGCCATTCATCCATTTACGGCCTTGATGCGTGCATACTTTGTTGAA AACTGAATAATTGTGCAAGGTACATCAATTTCTGCGCGTACCAAAGCATG GTCATCCAAGAGCAGGGAGACCATGCACAACATATATTTATCAACTGCGC GAGAATATCCGGATGCGTGCTGCACCTTTGAAAACCTTCATAAAGCTATG GAGGATATGGAAAGCCAGAGGAAAAGTGACAGACATCCGACATAGACAAC AAGACAATGATGGTGATGATGACGATGAACAATTTATCAAGACTGACTCC ATGATTCTCCAATCTTCCAGGTGTAAATTGTACCGATGCTGTCGCGCCTC TGTCTCACGGTGCCAAGGAGTACACCTGCGGCAGCTGCCCAGCTGGCATG GTGGGCGACGGGGAGTCCTGTGTGGATCTGGACGAGTGCCTCTTAGCCTC TAACGACGCCAACGTGCACCAGTGTAAGAACGCCACCTGCTTCAACGAGG CCCCTGGTTACCGCTGCGAGTGTCTGTCTGGGTACAGCATGATGGCTGAC AACAGGACATGCA

Coding sequence (CDS) from alignment at Sc0000241:12073..13335-

>transcript:BL96885_cuf1 ID=transcript:BL96885_cuf1|Name=transcript:BL96885_cuf1|organism=Branchiostoma lanceolatum|type=CDS|length=1935bp|location=Sequence derived from alignment at Sc0000241:12073..13335- (Branchiostoma lanceolatum)
GCGAACATCCCGCCGGTCTTCAATGTGACGTCAGAGATCCGGGCTACCGT
TGGTCAGGAGTACGGGCTGCAGCTGGAGGCTACAGACGACGGTTCGGTCA
CCATCACCGTCGCGCAGGGGCCGGGAAGTCTCAACGGCAGTAACTACTAC
ACGTGGACGCCTTCCGACACGTCTAACTACACTATCCAGTTTCTGGCCAC
GGATGACGTCGGTGCCTCCACATCTCAGACCCCCGACATCACGGTGTGCG
CATGTCAAAACAATGGTACCTGCAATTTCGATACCACCCTGACGGCACGT
AGCTTTGGGTTCGCCATCTCCACATGCAACTGTCAGCTCGGCTTCGTCGG
CGACTACTGTGAGACGGACTACAACGGCTGCTCTGTCACACCTTGCTATC
CAGGTGTAAATTGTACCGATGCTGTCGCGCCTCTGTCTCACGGTGCCAAG
GAGTACACCTGCGGCAGCTGCCCAGCTGGCATGGTGGGCGACGGGGAGTC
CTGTGTGGATCTGGACGAGTGCCTCTTAGCCTCTAACGACGCCAACGTGC
ACCAGTGTAAGAACGCCACCTGCTTCAACGAGGCCCCTGGTTACCGCTGC
GAGTGTCTGTCTGGGTACAGCATGATGGCTGACAACAGGACATGCGCGAA
CATCCCGCCGGTCTTCAATGTGACGTCAGAGATCCGGGCTACCGTTGGTC
AGGAGTACGGGCTGCAGCTGGAGGCTACAGACGACGGTTCGGTCACCATC
ACCGTCGCGCAGGGGCCGGGAAGTCTCAACGGCAGTAACTACTACACGTG
GACGCCTTCCGACACGTCTAACTACACTATCCAGTTTCTGGCCACGGATG
ACGTCGGTGCCTCCACATCTCAGACCCCCGACATCACGGTGTGCGCATGT
CAAAACAATGGTACCTGCAATTTCGATACCACCCTGACGGCACGTAGCTT
TGGGTTCGCCATCTCCACATGCAACTGTCAGCTCGGCTTCGTCGGCGACT
ACTGTGAGACGGACTACAACGGCTGCTCTGTCACACCTTGCTATCCAGGT
GTAAATTGTACCGATGCTGTCGCGCCTCTGTCTCACGGTGCCAAGGAGTA
CACCTGCGGCAGCTGCCCAGCTGGCATGGTGGGCGACGGGGAGTCCTGTG
TGGATCTGGACGAGTGCCTCTTAGCCTCTAACGACGCCAACGTGCACCAG
TGTAAGAACGCCACCTGCTTCAACGAGGCCCCTGGTTACCGCTGCGAGTG
TCTGTCTGGGTACAGCATGATGGCTGACAACAGGACATGCGCGAACATCC
CGCCGGTCTTCAATGTGACGTCAGAGATCCGGGCTACCGTTGGTCAGGAG
TACGGGCTGCAGCTGGAGGCTACAGACGACGGTTCGGTCACCATCACCGT
CGCGCAGGGGCCGGGAAGTCTCAACGGCAGTAACTACTACACGTGGACGC
CTTCCGACACGTCTAACTACACTATCCAGTTTCTGGCCACGGATGACGTC
GGTGCCTCCACATCTCAGACCCCCGACATCACGGTGTGCGCATGTCAAAA
CAATGGTACCTGCAATTTCGATACCACCCTGACGGCACGTAGCTTTGGGT
TCGCCATCTCCACATGCAACTGTCAGCTCGGCTTCGTCGGCGACTACTGT
GAGACGGACTACAACGGCTGCTCTGTCACACCTTGCTATCCAGGTGTAAA
TTGTACCGATGCTGTCGCGCCTCTGTCTCACGGTGCCAAGGAGTACACCT
GCGGCAGCTGCCCAGCTGGCATGGTGGGCGACGGGGAGTCCTGTGTGGAT
CTGGACGAGTGCCTCTTAGCCTCTAACGACGCCAACGTGCACCAGTGTAA
GAACGCCACCTGCTTCAACGAGGCCCCTGGTTACCGCTGCGAGTGTCTGT
CTGGGTACAGCATGATGGCTGACAACAGGACATGC
Gene-mRNA-Prot
This mRNA is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
gene:BL96885gene:BL96885Branchiostoma lanceolatumgene
The following polypeptide feature(s) derives from this mRNA:
Feature NameUnique NameSpeciesType
transcript:BL96885_cuf1transcript:BL96885_cuf1-proteinBranchiostoma lanceolatumpolypeptide
The following exon feature(s) are a part of this mRNA:
Feature NameUnique NameSpeciesType
BL96885_cuf1-E1BL96885_cuf1-E1-1564476830-404464Branchiostoma lanceolatumexon
BL96885_cuf1-E2BL96885_cuf1-E2-1564476830-404461Branchiostoma lanceolatumexon
BL96885_cuf1-E3BL96885_cuf1-E3-1564476830-404459Branchiostoma lanceolatumexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sc0000241genomeSc0000241:12073..13335 -
Properties
Property NameValue
Transcript idBL96885_cuf1
Biotypeprotein_coding